KEGG   Pongo abelii (Sumatran orangutan): 100436271
Entry
100436271         CDS       T01416                                 

Gene name
NKX3-1
Definition
(RefSeq) homeobox protein Nkx-3.1
  KO
K09348  homeobox protein Nkx-3.1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05200  Pathways in cancer
pon05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100436271 (NKX3-1)
  09162 Cancer: specific types
   05215 Prostate cancer
    100436271 (NKX3-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100436271 (NKX3-1)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, NK-2
    100436271 (NKX3-1)
SSDB
Motif
Pfam: Homeodomain Trypan_PARP Homeobox_KN Homez
Other DBs
NCBI-GeneID: 100436271
NCBI-ProteinID: XP_002818954
Ensembl: ENSPPYG00000018442
UniProt: H2PPU3 A0A6D2WX06
LinkDB
Position
8
AA seq 236 aa
MLRAPEPRPGEAKAEEAAPPTPSKPLTSFLIQDILRDGAQRQGGHTSSPRQRDPVPEPEP
EPEPEGGRGRVGAQNDQLSPGPRAAPEEAETLAETEPERHLGSYLLDCENTSGALPRLPQ
TTKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYK
TKRKQLSSELGDLEKHSSLPALKEEAFSRASLVSVYNSYPYYPYLYCVGSWSPAFW
NT seq 711 nt   +upstreamnt  +downstreamnt
atgctcagggctccggagccgcggcccggggaggcgaaagcggaggaggccgcgccgccg
accccgtccaagccgctcacgtccttcctcatccaggacatcctgcgggacggcgcgcag
cggcaaggcggccacacgagcagcccgagacagcgcgacccggtgccggagccagagcca
gagccagagccagagggaggacgcggccgcgtcggggcgcagaacgaccagctgagcccc
gggccccgcgccgcgccggaggaggccgagacgctggcggagaccgagccagaaaggcac
ttggggtcttatctgttggactgtgaaaacacttcaggcgcccttccaaggcttccccaa
accactaagcagccgcagaagcgctcccgagctgccttctcccacactcaggtgatcgag
ttggagaggaagttcagccatcagaagtacctgtcggcccctgaacgggcccacctggcc
aagaacctcaagctcacggagacccaagtgaagatatggttccagaacagacgctataag
actaagcgaaagcagctctcctcggagctgggagacttggagaagcattcctctttgccg
gccctgaaagaggaggccttctcccgggcctccctggtctccgtgtataacagctatcct
tactacccatacctgtactgcgtgggcagctggagcccagctttttggtaa

DBGET integrated database retrieval system