KEGG   Pongo abelii (Sumatran orangutan): 100436498
Entry
100436498         CDS       T01416                                 

Gene name
SRC
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase Src isoform X1
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon04012  ErbB signaling pathway
pon04015  Rap1 signaling pathway
pon04062  Chemokine signaling pathway
pon04137  Mitophagy - animal
pon04144  Endocytosis
pon04360  Axon guidance
pon04370  VEGF signaling pathway
pon04510  Focal adhesion
pon04520  Adherens junction
pon04530  Tight junction
pon04540  Gap junction
pon04611  Platelet activation
pon04613  Neutrophil extracellular trap formation
pon04625  C-type lectin receptor signaling pathway
pon04727  GABAergic synapse
pon04750  Inflammatory mediator regulation of TRP channels
pon04810  Regulation of actin cytoskeleton
pon04912  GnRH signaling pathway
pon04915  Estrogen signaling pathway
pon04917  Prolactin signaling pathway
pon04919  Thyroid hormone signaling pathway
pon04921  Oxytocin signaling pathway
pon04926  Relaxin signaling pathway
pon05100  Bacterial invasion of epithelial cells
pon05135  Yersinia infection
pon05152  Tuberculosis
pon05161  Hepatitis B
pon05163  Human cytomegalovirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05203  Viral carcinogenesis
pon05205  Proteoglycans in cancer
pon05219  Bladder cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100436498 (SRC)
   04015 Rap1 signaling pathway
    100436498 (SRC)
   04370 VEGF signaling pathway
    100436498 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100436498 (SRC)
   04137 Mitophagy - animal
    100436498 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100436498 (SRC)
   04520 Adherens junction
    100436498 (SRC)
   04530 Tight junction
    100436498 (SRC)
   04540 Gap junction
    100436498 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100436498 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100436498 (SRC)
   04613 Neutrophil extracellular trap formation
    100436498 (SRC)
   04625 C-type lectin receptor signaling pathway
    100436498 (SRC)
   04062 Chemokine signaling pathway
    100436498 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100436498 (SRC)
   04915 Estrogen signaling pathway
    100436498 (SRC)
   04917 Prolactin signaling pathway
    100436498 (SRC)
   04921 Oxytocin signaling pathway
    100436498 (SRC)
   04926 Relaxin signaling pathway
    100436498 (SRC)
   04919 Thyroid hormone signaling pathway
    100436498 (SRC)
  09156 Nervous system
   04727 GABAergic synapse
    100436498 (SRC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100436498 (SRC)
  09158 Development and regeneration
   04360 Axon guidance
    100436498 (SRC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100436498 (SRC)
   05203 Viral carcinogenesis
    100436498 (SRC)
  09162 Cancer: specific types
   05219 Bladder cancer
    100436498 (SRC)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100436498 (SRC)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100436498 (SRC)
   05152 Tuberculosis
    100436498 (SRC)
   05100 Bacterial invasion of epithelial cells
    100436498 (SRC)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100436498 (SRC)
   05168 Herpes simplex virus 1 infection
    100436498 (SRC)
   05163 Human cytomegalovirus infection
    100436498 (SRC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100436498 (SRC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100436498 (SRC)
   01522 Endocrine resistance
    100436498 (SRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100436498 (SRC)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100436498 (SRC)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100436498 (SRC)
Protein kinases [BR:pon01001]
 Non-receptor tyrosine kinases
  SRC family
   100436498 (SRC)
Membrane trafficking [BR:pon04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    100436498 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    100436498 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    100436498 (SRC)
  Macropinocytosis
   Kinases
    100436498 (SRC)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2
Other DBs
NCBI-GeneID: 100436498
NCBI-ProteinID: XP_024094811
Ensembl: ENSPPYG00000010985
LinkDB
Position
20
AA seq 542 aa
MGSNKSKPKDASQRRRSLEPTENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTRKV
DVREGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGT
FLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYS
KHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTR
VAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLK
GETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLI
EDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREV
LDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGE
NL
NT seq 1629 nt   +upstreamnt  +downstreamnt
atgggcagcaacaagagcaagcccaaggatgccagccagcggcgccgcagcctggagccc
accgagaacgtgcacggcgctggcgggggcgctttccccgcctcgcagacccccagcaag
ccagcctcggccgacggccaccgcggcccaagtgcggccttcgcccccgcggccgccgag
cccaagctgttcggaggcttcaactcctcggacaccgtcacctccccgcagagggcgggc
ccgctggccgggggagtgaccacctttgtggccctctatgactatgagtctaggacggag
acagacctgtccttcaagaaaggcgagcggctccagattgtcaacaacacgaggaaggtg
gatgtcagagagggagactggtggctggcccactcgctcagcacaggacagacaggctac
atccccagcaactacgtggcgccctccgactccatccaggccgaggagtggtattttggc
aagatcaccagacgggagtcagagcggttactgctcaacgcggagaacccgagagggacc
ttcctcgtgcgagaaagtgagaccacgaaaggtgcctactgcctctcagtgtctgacttc
gacaacgccaagggcctcaacgtgaagcactacaagatccgcaagctggacagcggcggc
ttctacatcacctcccgcacccagttcaacagcctgcagcagctggtggcctactactcc
aaacacgccgacggcctgtgccaccgcctcaccaccgtgtgccccacgtccaagccacag
actcagggcctggccaaggatgcctgggagatccctcgggagtcgctgcggctggaggtc
aagctgggccagggctgctttggcgaggtgtggatggggacctggaacggtaccaccagg
gtggccatcaaaaccctgaagcccggcacgatgtctccagaggccttcctacaggaggcc
caggtcatgaagaagctgaggcatgagaagctggtgcagttgtatgctgtggtttcggag
gagcctatttacatcgtcacggagtacatgagcaaggggagtttgctggactttctcaag
ggggagacaggcaagtacctgcggctgcctcagctggtggacatggctgctcagatcgcc
tcaggcatggcatacgtggagcggatgaactacgtccaccgggaccttcgtgcagccaac
atcctggtgggagagaacctggtgtgcaaagtggccgacttcgggctggctcggctcatc
gaagacaatgagtacacggcgcggcaaggtgccaaattccccatcaagtggacggctccg
gaagctgccctctatggccgcttcaccatcaagtcggacgtatggtccttcgggatcctg
ctgactgagctcaccacaaagggacgggtgccctaccctgggatggtgaaccgcgaggtg
ctggaccaggtggagcggggctaccggatgccctgcccgccggagtgtcccgagtccctg
cacgacctcatgtgccagtgctggcggaaggagcctgaggagcggcccaccttcgagtac
ctgcaggccttcctggaggactacttcacgtccaccgagccccagtaccagcccggggag
aacctctag

DBGET integrated database retrieval system