KEGG   Pongo abelii (Sumatran orangutan): 100436747Help
Entry
100436747         CDS       T01416                                 

Gene name
CAMK2D
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit delta isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04012  ErbB signaling pathway
pon04020  Calcium signaling pathway
pon04024  cAMP signaling pathway
pon04066  HIF-1 signaling pathway
pon04114  Oocyte meiosis
pon04217  Necroptosis
pon04261  Adrenergic signaling in cardiomyocytes
pon04310  Wnt signaling pathway
pon04360  Axon guidance
pon04713  Circadian entrainment
pon04720  Long-term potentiation
pon04722  Neurotrophin signaling pathway
pon04725  Cholinergic synapse
pon04728  Dopaminergic synapse
pon04740  Olfactory transduction
pon04750  Inflammatory mediator regulation of TRP channels
pon04911  Insulin secretion
pon04912  GnRH signaling pathway
pon04916  Melanogenesis
pon04921  Oxytocin signaling pathway
pon04922  Glucagon signaling pathway
pon04925  Aldosterone synthesis and secretion
pon04934  Cushing syndrome
pon04971  Gastric acid secretion
pon05031  Amphetamine addiction
pon05152  Tuberculosis
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05214  Glioma
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100436747 (CAMK2D)
   04310 Wnt signaling pathway
    100436747 (CAMK2D)
   04066 HIF-1 signaling pathway
    100436747 (CAMK2D)
   04020 Calcium signaling pathway
    100436747 (CAMK2D)
   04024 cAMP signaling pathway
    100436747 (CAMK2D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100436747 (CAMK2D)
   04217 Necroptosis
    100436747 (CAMK2D)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100436747 (CAMK2D)
   04922 Glucagon signaling pathway
    100436747 (CAMK2D)
   04912 GnRH signaling pathway
    100436747 (CAMK2D)
   04921 Oxytocin signaling pathway
    100436747 (CAMK2D)
   04916 Melanogenesis
    100436747 (CAMK2D)
   04925 Aldosterone synthesis and secretion
    100436747 (CAMK2D)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100436747 (CAMK2D)
  09154 Digestive system
   04971 Gastric acid secretion
    100436747 (CAMK2D)
  09156 Nervous system
   04725 Cholinergic synapse
    100436747 (CAMK2D)
   04728 Dopaminergic synapse
    100436747 (CAMK2D)
   04720 Long-term potentiation
    100436747 (CAMK2D)
   04722 Neurotrophin signaling pathway
    100436747 (CAMK2D)
  09157 Sensory system
   04740 Olfactory transduction
    100436747 (CAMK2D)
   04750 Inflammatory mediator regulation of TRP channels
    100436747 (CAMK2D)
  09158 Development and regeneration
   04360 Axon guidance
    100436747 (CAMK2D)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100436747 (CAMK2D)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100436747 (CAMK2D)
   05205 Proteoglycans in cancer
    100436747 (CAMK2D)
  09162 Cancer: specific types
   05214 Glioma
    100436747 (CAMK2D)
  09165 Substance dependence
   05031 Amphetamine addiction
    100436747 (CAMK2D)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100436747 (CAMK2D)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100436747 (CAMK2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100436747 (CAMK2D)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     100436747 (CAMK2D)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   100436747 (CAMK2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr DUF4440 SnoaL_3 Pkinase_fungal Kdo SnoaL_4 SnoaL_2 DUF4915
Motif
Other DBs
NCBI-GeneID: 100436747
NCBI-ProteinID: XP_024101591
Ensembl: ENSPPYG00000015013
LinkDB All DBs
Position
4
AA seq 533 aa AA seqDB search
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT
VTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSAAKSLLKKPDGVKINNKANVVTSPKENIPTPALEPQTTVIHNPDG
NKESTESSNTTIEDEDVKARKQEIIKVTEQLIEAINNGDFEAYTKICDPGLTAFEPEALG
NLVEGMDFHRFYFENALSKSNKPIHTIILNPHVHLVGDDAACIAYIRLTQYMDGSGMPKT
MQSEETRVWHRRDGKWQNVHFHRSGSPTVPIKPPCIPNGKENFSGGTSLWQNI
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgaccacaacctgcaccaggttcacggacgagtatcagcttttcgaggagctt
ggaaagggggcattctcagtggtgagaagatgtatgaaaattcctactggacaagaatat
gctgccaaaattatcaacaccaaaaagctttctgctagggatcatcagaaactagaaaga
gaagctagaatttgccgtcttttgaagcaccctaatattgtgcgacttcatgatagcata
tcagaagagggctttcactacttggtgtttgatttagttactggaggtgaactgtttgaa
gacatagtggcaagagaatactacagtgaagctgatgccagtcattgtatacagcagatt
ctagaaagtgtaaatcattgtcacctaaatggcatagttcacagggacctgaagcctgag
aatttgcttttagctagcaaatccaagggagcagctgtgaaattggcagactttggctta
gccatagaagttcaaggggaccagcaggcgtggtttggttttgctggcacacctggatat
ctttctccagaagttttacgtaaagatccttatggaaagccagtggatatgtgggcatgt
ggtgtcattctctatattctacttgtggggtatccacccttctgggatgaagaccagcac
agactctatcagcagatcaaggctggagcttatgattttccatcaccagaatgggacacg
gtgactcctgaagccaaagacctcatcaataaaatgcttactatcaaccctgccaaacgt
atcacagcctcagaggcactgaagcacccatggatctgtcaacgttctactgttgcttcc
atgatgcacagacaggagactgtagactgcttgaagaaatttaatgctagaagaaaacta
aagggtgccatcttgacaactatgctggctacaaggaatttctcagcagccaagagtttg
ttgaagaaaccagatggagtaaagataaacaacaaagccaacgtggtaaccagccccaaa
gaaaatattcctaccccggcgctggaaccccaaactactgtaatccacaaccctgatgga
aacaaggagtcaactgagagttcaaatacaacaattgaggatgaagatgtgaaagcacga
aagcaagagattatcaaagtcactgaacaactgatcgaagctatcaacaatggggacttt
gaagcctacacaaaaatctgtgacccaggccttactgcttttgaacctgaagctttgggt
aatttagtggaagggatggattttcaccgattctactttgaaaatgctttgtccaaaagc
aataaaccaatccacactattattctaaaccctcatgtacatctggtaggggatgatgcc
gcctgcatagcatatattaggctcacacagtacatggatggcagtggaatgccaaagaca
atgcagtcagaagagactcgtgtgtggcaccgccgggatggaaagtggcagaatgttcat
tttcatcgctcggggtcaccaacagtacccatcaagccaccctgtattccaaatgggaaa
gaaaacttctcaggaggcacctctttgtggcaaaacatctaa

DBGET integrated database retrieval system