KEGG   Pongo abelii (Sumatran orangutan): 100436768
Entry
100436768         CDS       T01416                                 

Gene name
NOTCH4
Definition
(RefSeq) neurogenic locus notch homolog protein 4
  KO
K20996  Notch 4
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04330  Notch signaling pathway
pon04919  Thyroid hormone signaling pathway
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05206  MicroRNAs in cancer
pon05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100436768 (NOTCH4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100436768 (NOTCH4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100436768 (NOTCH4)
   05206 MicroRNAs in cancer
    100436768 (NOTCH4)
  09162 Cancer: specific types
   05224 Breast cancer
    100436768 (NOTCH4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100436768 (NOTCH4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100436768 (NOTCH4)
SSDB
Motif
Pfam: EGF hEGF EGF_CA Ank_2 Ank Ank_5 Notch Ank_3 Ank_4 NODP EGF_2 NOD cEGF
Other DBs
NCBI-GeneID: 100436768
NCBI-ProteinID: XP_024104526
Ensembl: ENSPPYG00000016488
LinkDB
Position
6
AA seq 2002 aa
MQPPSLLLLLLLLLLLCVSVVITRGLLCGSFPEPCANGGTCLSLSLGQGTCQCAPGFLGE
TCQFPDPCQNAQLCQNGGSCQALLPAPLGLPSSPSPLTPSFLCTCLPGFTGERCQAQLED
PCPTSFCSKRGRCHIQASGRPQCSCMPGWTGEQCQLRDFCSANPCVNGGVCLATYPQIQC
HCPPGFEGHACERDVNECFQDPGPCPKGTSCHNTLGSFQCLCPVGREGPRCELRAGPCPP
RGCSNGGTCQLMPGKDSTFHLCLCPPGFIGPDCEVNPDNCVSHQCQNGGTCQDGLDTYTC
LCPETWTGWDCSEDVDECETQGPPHCRNGGTCQNSAGSFHCVCVSGWGGTSCEENLDDCI
AATCAPGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPCHGDAQCSTNPLTGSTLCLC
QPGYSGPTCHQDLDECLMAQQGPSPCEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECL
SQPCHPGSTCLDLLATFHCLCPPGLEGQLCEVETNECASAPCLNHADCHDLLNGFQCICL
PGFAGTRCEEDIDECRNSPCANGGQCQDQPGAFHCECLPGFEGTRCQTEVDECLSDPCPV
GASCIDLPGAFFCLCPSGFTGQLCEVPLCAPNLCQPKQICKDQKDKANCLCPDGSPGCAP
PEDNCTCHHGHCQRSSCVCDVGWTGPECEAELGSCISAPCAHGGTCYPQPSGYNCTCPTG
YTGPTCSEETTACHSGPCLNGGSCNPSPGGYYCTCPPSHTGPQCQTSTDYCGSAPCFNGG
TCVNRPGTFSCLCATGFQGPRCEGKIRPSCADSPCRNTATCQDSPQGPRCLCPTGYTGGS
CQTLMDLCAQKPCPRNSHCLQTGPSFHCLCLQGWTGPLCNLPLSSCQKAALSQGIDVSSL
CHNGGLCVDSGPSYFCHCPPGFQGSLCQDHVNPCESRPCQNGATCMAQPSGYLCQCAPGY
DGQNCSKELDACQSQPCHNHGTCTPKPGGFHCACPPGFVGLRCEGDVDECLDQPCHPTGT
AACHSLANAFYCQCLPGHTGQWCEVEIDPCHSQPCFHGGTCEATAGSPLGFICHCPKGFE
GPTCSHRAPSCGLHHCHHGGLCLPSPKPGFPPRCACLSGYGGPDCLTPPAPKGCGPPSPC
LYNGSCSETTGLGGPGFRCSCPHSSPGPRCQKPGAKGCEGRSGDGACDAGCSGPEGNWDG
GDCSLGVPDPWKGCPSHSRCWLLFRDGQCHPQCDSEECLFDGYDCETPPACTPAYDQYCH
DHFHNGHCEKGCNTAECGWDGGDCRPEDGDPEWGPSLALLVVLRPPALDQQLFALARVLS
LTLRVGLWVRKDRDGRDMVYPYPGARAEEKLGGTRDPTYQERAAPQTQPLGKETDSLSAG
FVVVMGVDLSRCGPDHPASRCPWDPGLLLRFLAAMAAVGALEPLLPGPLLAVHPHAGTAP
PANQLPWPVLCSPVAGVILLALGALLVLQLIRRRRREHGALWLPPGFTRRPRTQSAPHRR
RPPLGEDSIGLKALKPEAEVDEDGVVMCSGPEEGEEVDQAEETGPPSKCQLWSLSGGCGA
LPQAAMLTPPQESEMEAPDLDTRGPDGVTPLMSAVCCGEVESRTFQEAWLGCPEPWEPLL
DGGACPQAHTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHAAVAADAR
EVCQLLLRSRQTAVDARTEDGTTPLMLAARLAVEDLVEELIAAQADVGARDKWGKTALHW
AAAVNNARAARSLLQAGADKDAQDNREQTPLFLAAREGAVEVAQLLLGLGAARELRDQAG
LAPADVARQRNHWDLLTLLEGAGPPEARHKATPGREAGPFPRARTASVSVPPHGGGALPR
CRTLSAGAGPRGGGACLQARTWSVDLAARGGGAYSHCRSLSGVGAGGGPPPRGRRFSAGM
RGPRPNPAIMRGRYGVAAGRGGRVSTDDWPCDWVALGACGSASNIPIPPPCLTPSPERGS
PQLDCGPSAHQEMPINQGGEGK
NT seq 6009 nt   +upstreamnt  +downstreamnt
atgcagcccccttcactgctgctgctgctgctgctgctgctgctgctatgtgtctcagtg
gtcataaccagagggctgctgtgtgggagtttcccagaaccctgtgccaatggaggcacc
tgcctgagcctgtctctgggacaagggacctgccagtgtgcccctggcttcctgggtgag
acgtgccagtttcctgacccctgccagaacgcccagctctgccaaaatggaggcagctgc
caagccctgcttcccgctcccctggggctccccagctctccctctccattgacacccagc
ttcttgtgcacttgcctccctggcttcactggcgagagatgccaggcccagcttgaagac
ccttgtcctacctccttctgttccaaaaggggccgctgccacatccaggcctcgggccgc
ccacagtgctcttgcatgcctggatggacaggtgagcagtgccagcttcgggacttctgc
tcagccaacccatgtgttaatggaggggtgtgtctggccacgtacccccagatccagtgc
cactgcccaccgggcttcgagggccatgcctgtgaacgtgatgtcaacgagtgcttccag
gacccaggaccctgccccaaaggcacctcctgccataacaccctgggctccttccagtgc
ctctgccctgtggggcgggagggtccacgttgtgagctgcgggcaggaccctgccctccc
aggggctgttcaaatgggggcacctgccagctgatgccaggaaaagactccacctttcac
ctctgcctctgtcccccaggtttcataggcccggactgtgaggtgaatccagacaactgt
gtcagccaccaatgtcagaatgggggcacttgccaggatgggctggacacctacacctgc
ctctgcccagaaacctggacaggctgggattgctccgaagatgtggatgagtgtgagacc
cagggtccccctcactgcagaaacgggggcacctgccagaactctgctggtagctttcac
tgcgtgtgtgtgagtggctgggggggcacaagctgtgaggagaacctggatgactgtatt
gctgccacctgtgccccaggatccacctgcattgaccgagtgggctctttctcctgcctc
tgcccacctggacgcacaggactcctgtgccacttggaagacatgtgtctgagccagccg
tgccatggggatgcccagtgcagcaccaaccccctcacaggctccacactctgcctgtgt
cagcccggctattcagggcccacctgccaccaggacctggacgagtgtctgatggcccag
caaggcccaagtccctgtgaacatggcggttcctgcctcaacactcctggctccttcaac
tgcctctgtccacctggctacacaggctcccgttgtgaggctgatcacaatgagtgcctc
tcccagccctgccacccagggagcacctgtctggacctacttgccaccttccactgcctc
tgcccaccaggcttagaagggcaactctgtgaggtggagaccaacgagtgtgcctcagct
ccctgcctgaaccacgcggattgccatgacctgctcaacggcttccagtgcatctgcctg
cctggattcgccggcacccgatgtgaggaggatatcgacgagtgcagaaactctccctgt
gccaatggtgggcagtgccaggaccagcctggagccttccactgcgagtgtctcccaggc
tttgaaggtacacgctgtcaaacagaggtggatgagtgcctgagtgacccatgtcccgtt
ggagccagctgcattgatcttccaggagccttcttttgcctctgcccctctggtttcaca
ggccagctctgtgaggttcccctgtgtgctcccaacctgtgccagcccaagcagatatgt
aaggaccagaaagacaaggccaactgcctctgtcctgatggaagccctggctgtgcccca
cctgaggacaattgcacctgccaccatgggcactgccagagatcctcatgtgtgtgtgat
gtgggttggacggggccagagtgtgaggcagagctagggagctgcatctctgcaccctgt
gcccatggggggacctgctacccccagccctctggctacaactgtacctgccctacaggc
tacacagggcccacctgtagtgaggagacgacagcttgtcactcagggccatgtctcaat
ggcggctcctgcaaccctagccctggaggctactactgcacctgccctccaagccacaca
gggccccagtgccaaaccagcactgactactgtgggtctgccccgtgcttcaatgggggt
acctgtgtgaacaggcctggcaccttctcctgcctctgtgccacgggcttccagggcccg
cgctgtgagggaaagatccgccccagctgtgcagacagcccctgtaggaatacggcaacc
tgccaggacagcccccagggtccccgctgcctctgccccactggctacaccggaggcagc
tgccagactctgatggacttatgtgcccagaagccctgcccacgcaattcccactgcctc
cagactgggccctccttccactgcttgtgcctccagggatggaccgggcctctctgcaac
cttccactgtcctcctgccagaaggctgcgctgagccaaggcatagacgtctcttcgctt
tgccacaatggaggcctctgtgtcgacagcggcccctcctatttctgccactgcccccct
ggattccaaggcagcctgtgccaggatcatgtgaacccatgtgagtccaggccttgccag
aacggggccacctgcatggcccagcccagtgggtatctctgccagtgtgccccaggctac
gatggacagaactgctcaaaggaactcgatgcttgtcagtcccaaccctgtcacaaccat
ggcacctgtactcccaaacctggaggcttccactgtgcctgccctccaggctttgtgggg
ctacgctgtgagggagacgtggacgagtgtctagaccagccctgccaccccacaggcact
gcagcctgccactctctggccaatgccttctactgccagtgtctgcctggacacacaggc
caatggtgtgaggtggagatagacccctgccacagccaaccctgctttcatggagggacc
tgtgaggccacagcaggatcacccctgggtttcatctgccactgccccaagggttttgaa
ggccccacctgcagccacagggccccttcctgcggcctccatcactgccaccacggaggc
ctgtgtctgccctcccctaagccaggcttcccaccacgctgtgcctgcctcagtggctat
gggggtcctgactgcctgaccccaccagctcctaaaggctgtggccctccctccccatgc
ctatacaatggcagctgctcagagaccacaggcttggggggcccaggctttcgatgctcg
tgccctcacagctctccagggccccggtgtcagaaacccggagccaaggggtgtgagggc
agaagtggagatggggcctgtgatgctggctgcagtggcccagaaggaaactgggatgga
ggggactgctctctgggagtcccagacccctggaagggctgcccctcccactctcggtgc
tggcttctcttccgggacgggcagtgccacccgcagtgtgactctgaagagtgtctgttt
gatggctacgactgtgagacccctccagcctgcactccagcctatgaccagtactgccac
gatcacttccacaacgggcactgtgagaaaggctgcaacactgcagagtgtggctgggat
ggaggtgactgcaggcctgaagatggggacccagagtgggggccctccctggccctactg
gtggtactgaggcccccagccctagaccagcagctgtttgccctggcccgggtgctgtcc
ctgactctgagggtaggactctgggtaaggaaggatcgtgacggcagggacatggtgtac
ccctatcctggggcccgggctgaagaaaagctaggaggaactcgggaccccacctatcag
gagagagcagcccctcaaacgcagcccctgggcaaggagaccgactccctcagtgctggg
tttgtggtggtaatgggtgtggatttgtcccgctgtggccctgaccacccggcatcccgc
tgtccctgggaccctgggcttctactccgcttccttgctgcgatggctgcagtgggagcc
ctggagcccctgctgcctggaccactgctggctgtccaccctcatgcagggaccgcaccc
cctgccaaccagcttccctggcctgtgctgtgctccccagtggccggggtgattctcctg
gccctaggggctcttctcgtcctccagctcatccggcgtcgacgccgagagcatggagct
ctctggctgccccctggtttcactcgacggcctcggactcagtcagctccccaccgacgc
cggcccccactgggcgaggacagcattggtctcaaggcactgaagccagaggcagaagtt
gatgaggatggagttgtgatgtgctcaggccctgaggagggagaggaggtggaccaggct
gaagaaacaggcccaccctccaagtgccagctctggtctctgagtggtggctgtggggcg
ctccctcaggcagccatgctaactcctccccaggaatccgagatggaagcccctgacctg
gacacccgtggacctgatggggtgacacccctgatgtcagcagtttgctgtggggaagta
gagtccaggaccttccaagaggcatggttgggatgtcctgagccctgggaacctctgctg
gatggaggggcctgtccccaggctcacaccgtgggcactggggagacccccctgcacctg
gctgcccgattctcccggccaaccgctgcccgccgcctccttgaggctggagccaacccc
aaccaaccagaccgggcagggcgcacaccccttcatgctgctgtggctgctgatgctcgg
gaggtctgccagcttctgctccgtagcagacaaactgcagtggacgctcgcacagaggac
gggaccacacccttgatgctggctgccagactagcggtggaagacctggttgaagaactg
attgcagcccaagcagacgtgggggccagagataaatgggggaaaactgcgctgcactgg
gctgctgccgtgaacaacgcccgagccgcccgctcacttctccaggccggagccgataaa
gatgcccaggacaacagggagcagacgccgctgttcctggcagcacgggaaggagcggtg
gaagtagcccagctgctgctggggctgggggcagcccgcgagctgcgggaccaggctggg
ctagcgcccgcggacgtcgctcgccaacgtaaccattgggatctgctgacgctgctggaa
ggggctgggccaccagaggcccgtcacaaagccacgccgggacgcgaggctgggcccttc
ccgcgcgcacggacggcgtcagtaagcgtgcccccgcatgggggcggggctctgccgcgc
tgccggacgctgtcagccggagcaggccctcgtgggggcggagcttgtctgcaggctcgg
acttggtccgtagacttggctgcgcgggggggcggggcctattctcattgccggagcctc
tcgggagtaggagcaggaggaggcccgccccctcgcggccgtaggttttctgcaggcatg
cgcgggcctcggcccaaccctgcgataatgcgaggaagatatggagtggctgccgggcgc
ggaggcagggtctcaacggatgactggccctgtgattgggtggccctgggagcttgcggt
tctgcctccaacattccgatcccgcctccttgccttactccgtccccggagcggggatca
cctcaacttgactgtggtccctcagcccaccaagaaatgcccataaaccaaggaggagag
ggtaaataa

KEGG   Pongo abelii (Sumatran orangutan): 100447628
Entry
100447628         CDS       T01416                                 

Gene name
NOTCH2
Definition
(RefSeq) neurogenic locus notch homolog protein 2 isoform X1
  KO
K20994  Notch 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04330  Notch signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04919  Thyroid hormone signaling pathway
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05206  MicroRNAs in cancer
pon05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100447628 (NOTCH2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100447628 (NOTCH2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100447628 (NOTCH2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100447628 (NOTCH2)
   05206 MicroRNAs in cancer
    100447628 (NOTCH2)
  09162 Cancer: specific types
   05224 Breast cancer
    100447628 (NOTCH2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100447628 (NOTCH2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100447628 (NOTCH2)
SSDB
Motif
Pfam: EGF hEGF EGF_CA DUF3454 NOD Notch EGF_2 Ank_2 Ank Ank_5 NODP Ank_3 Ank_4 EGF_3 cEGF
Other DBs
NCBI-GeneID: 100447628
NCBI-ProteinID: XP_009243797
LinkDB
Position
1
AA seq 2471 aa
MPALRPALPWALLALWLCCAAPARALQCRDGYEPCVNEGMCVTYHNGTGYCKCPEGFLGE
YCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGT
CHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLPGFTGQKCE
TDVNECDIPGHCQHGGTCLNLPGSYQCQCPQGFTGQYCDSLYVPCAPSPCVNGGTCRQTG
DFTFECSCLPGFEGSTCERNIDDCPNHRCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVD
ECLLQPNACQNGGTCANRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASF
SCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECA
MANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTC
LCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTP
CLNGAKCIDHPNGYECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYM
GAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGVNCEINFDDCASNPCIHGICM
DGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINGVNGFRCICPEGPHHPSCYSQ
VNECLSNPCIHGNCTGGLSGYKCLCDAGWIGINCEVDKNECLSNPCQNGGTCDNLVNGYR
CTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPN
PCENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDECISKPCMNHGLCHNTQGSYMCECP
PGFSGMDCEEDIDDCLANPCQNGGSCVDGVNAFSCLCLLGFTGDKCQTDMNECLSEPCKN
GGTCSDYVNSYTCKCQAGFDGVHCENNINECTESSCFNGGTCVDGINSFSCLCPVGFTGS
FCLHEINECSSHPCLNEGTCVDGLGTYRCSCPLGYTGKNCQTLVNLCSRSPCKNKGTCVQ
KKAESQCLCPSGWAGAYCDVPNVSCDIAASSRGVLVEHLCQHSGVCINAGNTHYCQCPLG
YTGSYCEEQLDECVSNPCQHGATCSDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGG
TCIDLVNHFKCSCPPGTRGLLCEENIDDCARGPHCLNGGQCMDRIGGYSCRCLPGFAGER
CEGDINECLSNPCSSEGSLDCIQLTNDYLCVCRSAFTGRHCETFIDVCPQMPCLNGGTCA
VASNMPDGFICRCPPGFSGARCQSSCGQVKCRKGEQCVHTASGPRCFCPSPRDCESGCAS
SPCQHGGSCHPQRQPPYYSCQCAPPFSGSRCELYTAPPSTPPATCLSQYCADKARDGVCD
EACNSHACQWDGGDCSLTMENPWANCSSPLPCWDYINNQCDELCNTAECLFDNFECQGNS
KTCKYDKYCADHFKDNHCDQGCNSEECGWDGLDCAADQPENLAEGTLVIVVLMPPEQLLQ
DARSFLRALGTLLHTNLRIKRDSQGELMVYPYYGEKSAAMKKQRMTRRSLPGEQEQEVAG
SKVFLEIDNRQCVQDSDHCFKNTDAAAALLASHAIQGTLSYPLVSVVSESLTPERTQLLY
LLAVAVVIILFIILLGVIMAKRKRKHGSLWLPEGFTLRRDASNHKRREPVGQDAVGLKNL
SVQVSEANLIGSGTSEHWVDDEGPQPKKVKAEDEALLSEEDDPIDRRPWTQQHLEAADIR
RTPSLALTPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDLSDEDEDAEDSSANIIT
DLVYQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAA
DAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELINCQADVNAVDDHGKSA
LHWAAAVNNVEATILLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDITD
HMDRLPRDVARDRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVICGPNRSFLSLKHTPMG
KKSRRPSAKSTMPTSLPNLAKEAKDAKGSRRKKSLSEKVQLSESSVTLSPVDSLESPHTY
VSDTTSSPMITSPGILQASPNPMLATAAPPAPVHAQHALSFSNLHEVQPLAHGASTVLPS
VSQLLSHHHIVSPGSGSAGSLSRLHPVPVPADWMNRMEVNETQYNEMFGMVLAPAEGTHP
GIAPQSRPPEGKHITTPREPLPPIVTFQLIPKGSIAQPAGAPQPQSTCPPAVAGPLPTMY
QIPEMARLPSVAFPTAMMPQQDGQVAQTILPAYHPFPASMGKYPTPPSQHSYASSNAAER
TPSHSGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGAGGGQRGPGTHMS
EPPHNNMQVYA
NT seq 7416 nt   +upstreamnt  +downstreamnt
atgcccgccctgcgccccgctctgccgtgggcgctgctggcgctctggctgtgctgcgcg
gcccccgcgcgtgcattgcagtgtcgagatggctatgaaccctgtgtaaatgaaggaatg
tgtgttacctaccacaatggcacaggatactgcaaatgtccagaaggcttcttgggagaa
tattgtcaacatcgagacccctgtgagaagaaccgctgccagaatggtgggacttgtgtg
gcccaggccatgctggggaaagccacgtgccgatgtgcctcagggttcacgggagaggac
tgccagtactcgacatctcatccatgctttgtgtctcgaccctgcctgaatggtggcaca
tgccatatgctcagtcgggatacctatgagtgcacctgtcaagtcgggtttacaggtaag
gagtgccaatggaccgatgcctgcctgtctcatccctgtgcaaatggaagtacctgtacc
actgtggccaaccagttctcctgcaaatgcctcccaggcttcacagggcagaagtgtgag
actgatgtcaatgagtgtgacattccaggacactgccagcatggtggcacctgcctcaac
ctgcctggttcctaccagtgccagtgccctcagggcttcacaggccagtactgtgacagc
ctgtatgtgccctgtgcaccctcgccttgtgtcaacggaggcacctgtcggcagactggt
gacttcacttttgaatgcagctgccttccaggttttgaagggagcacctgtgagagaaat
attgatgactgccctaaccacaggtgtcagaatggaggggtttgtgtggatggggtcaac
acttacaactgccgctgccccccacaatggacaggacagttctgcacagaggatgtggat
gaatgcctgctgcagcccaatgcctgtcagaatgggggcacctgtgccaaccgcaatgga
ggctatggctgtgtgtgtgtcaacggctggagtggagatgactgcagtgagaacattgat
gattgtgccttcgcctcctgtactccaggctccacctgcatcgaccgtgtggcctccttc
tcttgcatgtgcccagaggggaaggcaggtctcctgtgtcatctggatgatgcatgcatc
agcaatccttgccacaagggggcactgtgtgacaccaaccccctaaatgggcaatatatt
tgcacctgcccacaaggctacaaaggggctgactgcacagaagatgtggatgaatgtgcc
atggccaatagcaatccttgtgagcatgcaggaaaatgtgtgaacacggatggcgccttc
cactgtgagtgtctgaagggttatgcaggacctcgttgtgagatggacatcaatgagtgc
cattcagacccctgccagaatgatgctacctgtctggataagattggaggcttcacatgt
ctgtgcatgccaggtttcaaaggtgtgcattgtgaattagaaataaatgaatgtcagagc
aacccttgtgtgaacaatgggcagtgtgtggataaagtcaatcgtttccagtgcctgtgt
cctcctggttttactgggccagtttgccagattgatattgatgactgttccagtactccg
tgtctgaatggggcaaagtgtatcgatcacccgaatggctatgaatgccagtgtgccaca
ggtttcactggtgtgttgtgtgaggagaacattgacaactgtgaccccgatccttgccac
catggtcaatgtcaggatggtattgattcctacacctgcatctgcaatcccgggtacatg
ggcgccatctgcagtgaccagattgatgaatgttacagcagcccttgcctgaacgatggt
cgctgcattgacctggtcaatggctaccagtgcaactgccagccgggcacgtcaggggtt
aattgtgaaattaattttgatgactgtgcaagtaacccttgtatccatggaatctgtatg
gatggcattaatcgctacagttgtgtctgctcaccaggattcacagggcagagatgtaac
attgacattgatgagtgtgcctccaatccctgtcgcaagggtgcaacatgtatcaatggt
gtgaatggtttccgctgtatatgccccgagggaccccatcaccccagctgctactcacag
gtgaacgaatgcctgagcaatccctgcatccatggaaactgtactggaggtctcagtgga
tataagtgtctctgtgatgcaggctggattggcatcaactgtgaagtggacaaaaatgaa
tgcctttcgaatccatgccagaatggaggaacttgtgacaatctggtgaatggatacagg
tgtacttgcaagaagggctttaaaggctataactgccaggtgaatattgatgaatgtgcc
tcaaatccatgcctgaaccaaggaacctgctttgatgacataagtggctacacttgccac
tgtgtgctgccatacacaggcaagaattgtcagacagtattggctccctgttccccaaac
ccttgtgagaatgctgctgtttgcaaagagtcaccaaattttgagagttatacctgcttg
tgtgctcctggctggcaaggtcagcggtgtaccattgacattgacgagtgtatctccaag
ccctgcatgaaccatggtctctgccataacacccagggcagctacatgtgtgaatgtcca
ccaggcttcagtggtatggactgtgaggaggacatcgatgactgccttgccaatccttgc
cagaatggaggttcctgtgtggatggagtgaatgctttctcctgcctctgccttctgggt
ttcactggagataagtgccagacagacatgaatgagtgtctgagtgaaccgtgtaagaat
ggagggacctgctctgactacgtcaacagttacacttgcaagtgccaggcaggatttgat
ggagtccactgtgagaacaacatcaatgagtgcactgagagctcctgttttaatggtggc
acatgtgttgatgggattaactccttctcttgcttgtgccctgtgggtttcactggatcc
ttctgcctccacgagatcaatgaatgcagctctcatccatgcctgaatgagggaacgtgt
gttgatggcctgggtacctaccgctgcagctgccccctgggctacactgggaaaaactgt
cagactctggtgaacctctgcagtcggtctccatgtaaaaacaaaggtacttgtgttcag
aaaaaagcagagtcccagtgcctatgtccatctggatgggctggtgcctattgtgacgtg
cccaatgtctcttgtgacatagcagcctccagcagaggtgtgcttgttgaacacttgtgc
cagcactcaggtgtctgcatcaatgctggcaacacgcattactgtcagtgccccctgggc
tatactgggagctactgtgaggagcaacttgatgagtgtgtgtccaacccctgccagcac
ggggcaacatgcagtgacttcattggtggatacagatgcgagtgtgtcccaggctatcag
ggtgtcaactgtgagtatgaagtggatgagtgccagaatcagccctgccagaatggaggc
acctgtattgaccttgtgaaccatttcaagtgctcctgcccaccaggcactcggggccta
ctctgtgaagagaacattgatgactgtgcccggggtccccattgccttaatggtggtcag
tgcatggataggattggaggctacagttgtcgctgcttgcctggctttgctggggagcgt
tgtgagggagatatcaacgagtgcctctccaacccctgcagctctgagggcagcctggac
tgtatacagctcaccaatgactacctgtgtgtttgccgtagtgcctttactggccggcac
tgtgaaaccttcatcgatgtgtgtccccagatgccctgcctgaatggagggacttgtgct
gtggccagtaacatgcctgatggtttcatttgccgttgtcccccgggattttccggggca
aggtgccagagcagctgtggacaagtgaaatgtaggaaaggggagcagtgtgtgcacacc
gcctctggaccccgttgcttctgccccagtccccgggactgcgagtcaggctgtgccagt
agcccctgccagcacgggggcagctgccaccctcagcgccagcctccttattactcctgc
cagtgtgccccaccattctcgggtagccgctgtgaactctacacggcaccccccagcacc
cctcctgccacctgtctaagccagtattgtgctgacaaagctcgggatggcgtctgtgat
gaggcctgcaacagccatgcctgccagtgggatgggggtgactgttctctcaccatggag
aacccctgggccaactgctcctccccacttccctgctgggattatatcaacaaccagtgt
gatgagctgtgcaacacggccgagtgcctgtttgacaactttgaatgccaggggaacagc
aagacatgcaagtatgacaaatactgtgcagaccacttcaaagacaaccactgtgaccag
gggtgcaacagtgaggagtgtggttgggatgggctggactgtgctgctgaccaacctgag
aacctggcagaaggtaccctggttattgtggtattaatgccacctgaacaactgctccag
gatgctcgcagcttcttgagggcactgggtaccctgctccacaccaacctgcgcattaag
cgggactcccagggggaactcatggtgtacccctattatggtgagaagtcagctgccatg
aagaaacagaggatgacacgcaggtcccttcctggtgaacaagaacaggaggtggctggc
tctaaagtctttctggaaattgacaaccgccagtgtgttcaagactcagaccactgcttc
aagaacacggatgcagcagcagctcttctggcctctcacgccatacaggggaccctgtca
taccctcttgtgtctgtcgtcagtgaatccctgactccagaacgcactcagctcctctat
ctccttgctgttgctgttgtcatcattctgtttattattctgctgggggtaatcatggca
aaacgaaagcgtaagcatggctctctctggctgcctgaaggtttcactcttcgccgagat
gcaagcaatcacaagcgtcgtgagccagtgggacaggatgctgtggggctgaaaaatctc
tcagtgcaagtctcagaagctaacctaattggttctggaacaagtgaacactgggtcgat
gatgaagggccccagccaaagaaagtgaaggctgaagatgaggccttactctcagaagaa
gatgaccccattgatcgacggccatggacacagcagcaccttgaagccgcagacatccgt
aggacaccatcgctggccctcacccctcctcaggcagagcaggaggtggatgtgttagat
gtgaatgtccgtggcccagatggctgcaccccattgatgttggcttctctccgaggaggc
agctcagatttgagtgatgaagatgaagatgcagaggactcttctgctaacatcatcaca
gacttggtctaccagggtgccagcctccaggcccagacggaccggactggtgagatggcc
ctgcaccttgcagcccgctactcacgggctgatgctgccaagcgtctcctggatgcaggt
gcagatgccaatgcccaggacaacatgggccgctgcccactccatgctgcagtggcagct
gatgcccaaggtgtcttccagattctgattcgcaaccgagtaactgatctagatgctagg
atgaatgatggtactacacccctgatcctggctgcccgcctggctgtggagggaatggtg
gcagaactgatcaactgccaagcggatgtgaatgcagtggatgaccatggaaaatctgct
cttcactgggcagctgctgtcaataatgtggaggcgactattttgctgttgaaaaatggg
gccaaccgagacatgcaggacaacaaggaagagacacctctgtttcttgctgcccgggag
gggagctatgaagcagccaagatcctgttagaccattttgccaatcgagacatcacagac
catatggatcgtcttccccgggatgtggctcgggatcgcatgcaccatgacattgtgcgc
ctcctggatgaatacaatgtgaccccaagccctccaggcaccgtgttgacttctgctctc
tcacctgtcatctgtgggcccaacagatctttcctcagcctgaagcacaccccaatgggc
aagaagtctagacggcccagtgccaagagtaccatgcctactagcctccctaaccttgcc
aaggaggcaaaggatgccaagggtagtaggaggaagaagtctctgagtgagaaggtccag
ctgtctgagagttcagtaactttatcccctgttgattccctagaatctcctcacacatat
gtttccgacaccacatcctctccaatgattacatcccctgggatcttacaggcctcaccc
aaccctatgttggccactgccgcccctcctgccccagtccatgcccagcatgcactgtct
ttttctaaccttcatgaagtgcagcctttggctcatggggccagcactgtgcttccctca
gtgagccagttgctatcccaccaccacattgtgtctccaggcagtggcagtgctggaagc
ttgagtaggctccatccagtcccagtcccagcagattggatgaaccgcatggaggtgaat
gagacccagtacaatgagatgtttggtatggtcctggctccagctgagggcacccatcct
ggcatagctccccagagcaggccacctgaagggaagcacataaccacccctcgggagccc
ttgccccccattgtgactttccagctcatccctaaaggcagtattgcccaaccagcgggg
gctccccagcctcagtccacctgccctccagctgttgcgggccccctgcccaccatgtac
cagattccagaaatggcccgtttgcccagtgtggctttccccactgccatgatgccccag
caggacgggcaggtagctcagaccattctcccagcctatcatcctttcccagcctctatg
ggcaagtaccccacacccccttcacagcacagttatgcttcctcaaatgctgctgagcga
acacccagtcacagtggtcacctccagggtgagcatccctacctgacaccatccccagag
tctcctgaccagtggtcaagttcatcaccccactctgcttctgactggtcagatgtgacc
accagccctacccctgggggtgctggaggaggtcagcggggacctgggacacacatgtct
gagccaccacacaacaacatgcaggtttacgcgtga

KEGG   Pongo abelii (Sumatran orangutan): 100449179
Entry
100449179         CDS       T01416                                 

Gene name
NOTCH1
Definition
(RefSeq) neurogenic locus notch homolog protein 1
  KO
K02599  Notch 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04330  Notch signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04919  Thyroid hormone signaling pathway
pon05020  Prion disease
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05206  MicroRNAs in cancer
pon05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100449179 (NOTCH1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100449179 (NOTCH1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100449179 (NOTCH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100449179 (NOTCH1)
   05206 MicroRNAs in cancer
    100449179 (NOTCH1)
  09162 Cancer: specific types
   05224 Breast cancer
    100449179 (NOTCH1)
  09164 Neurodegenerative disease
   05020 Prion disease
    100449179 (NOTCH1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100449179 (NOTCH1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100449179 (NOTCH1)
SSDB
Motif
Pfam: EGF hEGF EGF_CA EGF_2 Notch NOD Ank_2 Ank DUF3454 NODP Ank_5 Ank_4 Ank_3 EGF_3
Other DBs
NCBI-GeneID: 100449179
NCBI-ProteinID: XP_024108478
LinkDB
Position
9
AA seq 2556 aa
MPPLLAPLLCLALLPALAARGPRCSQPGETCLNGGKCEAANGTEACVCGGAFVGPRCQDP
NPCLSTPCKNAGTCHVVDRGGVADYACSCPLGFSGPLCLTPLDNACLTNPCRNGGTCDLL
TLMEYKCRCPPGWSGKSCQQADPCASNPCTNGGQCLPFEASYICHCPPSFHGPTCRQDVN
ECGQNPGLCRHGGTCHNEVGSYRCVCRATHTGPNCERPYVPCSPSPCQNGGTCRPTGDVT
HECACLPGFTGQNCEENIDDCPGNNCKNGGACVDGVNTYNCRCPPEWTGQYCTEDVDECQ
LMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFHGATCHDRVASFYCE
CPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLGA
NPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMP
GYEGVHCEVNTDECASSPCLHNGRCLDKINEFQCECPTGFTGHLCQYDVDECASTPCKNG
AKCLDGPNTYTCVCTEGYTGTHCEVDIDECNPDPCHYGSCKDGVATFTCLCRPGYTGHHC
ETNINECSSQPCRHGGTCQDRDNAYLCFCLKGTTGPNCEINLDDCASSPCDSGTCLDKID
GYECACEPGYTGSMCNINIDECAGNPCHNGGTCEDGINGFTCRCPEGYHDPTCLSEVNEC
NSNPCVHGACRDSLNGYKCDCDPGWSGTNCDINNNECESNPCINGGTCKDMTSGYVCTCR
EGFSGPNCQTNINECASNPCLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPSPCRN
GGECRQSEDYESFSCVCPTGWQGQTCEVDINECVLSPCRHGASCQNTHGGYRCHCQAGYS
GRNCETDIDDCRPNPCHNGGSCTDGINTAFCDCLPGFQGTFCEEDINECASDPCRNGANC
TDCVDSYTCTCPAGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQH
DVNECDSQPCLHGGTCQDGCGSYRCTCPQGYTGPNCQNLVHWCDSSPCKNGGKCWQTHTQ
YRCECPSGWTGLYCDVPSVSCEVAAQRQGVDVAHLCQHGGLCVDAGNTHHCRCQAGYTGS
YCEDLVDECSPSPCQNGGTCTDYLGGYSCKCVAGYHGVNCSEEIDECLSHPCQNGGTCLD
LPNTYKCSCPRGTQGVHCEINVDDCNPPVDPMSRSPKCFNNGTCVDQVGGYSCTCPPGFV
GERCEGDVNECLSNPCDARGTQNCVQRVNDFHCECRAGHTGRRCESVINGCKGKPCKNGG
TCAVASNTARGFICKCPAGFEGATCENDARTCGSLRCLNGGTCISGPRSPTCLCLGPFTG
PECQFPASSPCLGGNPCYNQGTCEPTSESPFYRCLCPAKFNGLLCHILDYSFGGGAGRDI
PPPLIEEACELPECQEDAGNKVCSLQCNNHACGWDGGDCSLNFNDPWKNCTQSLQCWKYF
SDGHCDSQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFSDGHCDQGCNSAECEWDGLD
CAEHVPERLAAGTLVVVVLMPPEQLRNSSFHFLRELSRVLHTNVVFKRDARGQQMIFPYY
GREEELRKHPIKRAAEGWAAPDALLGQVKASLLPDGSGGGRRRRELDPMDVRGSIVYLEI
DNRQCVQASSQCFQSATDVAAFLGALASLGSLNIPYKIEAVQSETVEPPPPAQLHFMYVA
AAAFVLLFFVGCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNA
SDGALMDDNQNEWGDEDLETKKFRFEEPVVLPDLDDQTDHRQWTQQHLDAADLRMSAMAP
TPPQGEVDADCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASL
HNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQIL
IRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVNAVDDLGKSALHWAAAVNN
VDAAVVLLKNGANKDMQNNKEETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDI
AQERMHHDIVRLLDEYNLVRSPQLHGAPLGGTPTLSPPLCSPNGYLGSLKPSVQGKKVRK
PSSKGLACGSKEAKDLKARRKKSQDGKGCLLDSSGMLSPVDSLESPHGYLSDVASPPLLP
SPFQQSPSVPLNHLPGMPDTHLGIGHLNVAAKPEMAALGGGGRLAFETGPPRLSHLPVAS
GTSTVLGSGSGGALNFTVGGSTSLNGQCEWLSRLQSGMVPNQYNPLRGSVAPGPLSTQAP
SLQHGMVGPLHSSLAASALSQMMSYQGLPSTRLATQPHLVQTQQVQPQNLQMQQQNLQPP
NIQQQQSLQPPPPPPQPHLGVSSAASGHLSRSFLGGEPSQADVQPLGPSSLAVHTILPQE
SPALPTSLPSSLVPPVTAAQFLTPPSQHSYSSSPVDNTPSHQLQVPEHPFLTPSPESPDQ
WSSSSPHSNVSDWSEGVSSPPTSMQSQIARIPEAFK
NT seq 7671 nt   +upstreamnt  +downstreamnt
atgccgccgctcctggcgcccctgctctgcctggcgctgctgcccgcgctcgccgcacga
ggcccgcgatgctcccagcccggtgagacctgcctgaatggcgggaagtgtgaagcggcc
aatggcacggaggcctgcgtctgtggcggggccttcgtgggcccgcgatgccaggacccc
aacccgtgcctcagcaccccctgcaagaacgccgggacatgccacgtggtggaccgtgga
ggcgtggcagactatgcctgcagctgtcccctgggcttctctgggcccctctgcctgaca
cccctggacaacgcctgcctcaccaacccctgccgcaatgggggcacctgcgacctgctc
acactgatggagtacaagtgccgctgcccgcccggctggtcagggaaatcgtgccagcag
gctgacccgtgcgcctccaacccctgcaccaacggtggccagtgcctgcccttcgaggcc
tcctacatctgccactgcccacccagcttccacggccccacctgccggcaggatgtcaac
gagtgcggccagaaccccgggctttgccgccatggaggcacctgccacaacgaggtcggc
tcctaccgctgcgtctgccgcgccacccacaccggccccaactgcgagcggccctatgtg
ccctgcagcccctcgccctgccagaacgggggcacctgccgccccacgggcgacgtcacc
cacgagtgtgcctgcctgccaggcttcaccggccagaactgtgaggaaaatatcgatgat
tgtccaggaaacaactgcaagaacgggggcgcctgtgtggacggtgtgaacacctacaac
tgccgctgcccgccagagtggacaggtcagtactgtacagaggatgtggacgagtgccag
ctgatgccaaatgcctgccagaacggcgggacctgccacaacacccacggtggctacaac
tgcgtgtgtgtcaacggctggactggtgaggactgcagcgagaacattgatgactgtgcc
agcgccgcctgcttccacggcgccacctgccatgaccgcgtggcctccttctactgcgag
tgtccccacggccgcacaggtctgctgtgccacctcaacgatgcgtgcatcagcaacccc
tgcaacgagggctccaactgcgacaccaaccccgtcaatggcaaggccatctgcacctgc
ccctcggggtacacgggcccggcctgcagccaggatgtggatgagtgctcgctgggtgcc
aacccctgcgagcatgcgggcaagtgcatcaacacgctgggctccttcgagtgccagtgt
ctgcagggctacacaggcccccgctgcgagatcgacgtcaacgagtgcgtctcaaacccg
tgccagaacgacgccacctgcctggaccagattggggagttccagtgcatctgtatgcct
ggctacgagggtgtgcactgcgaggtcaacacggacgagtgcgccagcagcccctgcctg
cacaatggtcgctgcctggacaagatcaatgagttccagtgcgagtgccccacgggcttc
actgggcatctgtgccagtatgatgtggacgagtgtgccagcaccccctgcaagaatggt
gccaagtgcctggacggacccaacacttacacctgtgtgtgcacggaagggtacacgggg
acgcactgcgaggtggacatcgatgagtgcaaccccgacccctgccactacggctcctgc
aaggacggcgtcgccaccttcacctgcctctgccgcccgggctacacgggccaccactgc
gagaccaacatcaacgagtgctccagccagccctgccgccacgggggcacctgccaggac
cgtgacaacgcctacctctgcttctgcttgaaggggaccacaggacccaactgcgagatc
aacctggatgactgtgccagcagcccttgcgactcgggcacctgtctggacaagattgat
ggctacgagtgtgcctgtgagccgggctacacagggagcatgtgtaacatcaacatcgat
gagtgtgcgggcaacccctgccacaacgggggcacctgcgaggatggcatcaatggcttc
acctgccgctgccccgagggctaccacgaccccacctgcctgtctgaggtcaatgagtgc
aacagcaacccctgcgtccacggggcctgccgggacagcctcaacgggtacaagtgcgac
tgtgaccctgggtggagtgggaccaactgtgacatcaacaacaacgagtgtgagtccaac
ccttgtatcaacggcggcacctgcaaagacatgaccagtggctatgtgtgcacctgccgg
gagggcttcagcggtcccaactgccagaccaacatcaacgagtgtgcgtccaacccatgt
ctgaaccagggcacgtgtattgacgacgttgccgggtacaagtgcaactgcctgctaccc
tacacaggcgccacgtgtgaggtggtgctggccccgtgtgcccccagcccctgcagaaac
ggcggggagtgcaggcaatccgaggactatgagagcttctcctgcgtctgccccacgggc
tggcaagggcagacctgtgaggtcgacatcaacgagtgtgttctgagcccgtgccggcac
ggcgcatcctgccagaacacccacggcggctaccgctgccactgccaggccggctacagc
gggcgcaactgcgagaccgacatcgacgactgccggcccaacccgtgtcacaacggcggc
tcctgcacagatggcatcaacacggccttctgcgactgcctgcccggcttccagggcact
ttctgtgaggaggacatcaacgagtgtgccagtgacccctgccgcaacggggccaactgc
acggactgcgtggacagctacacgtgcacctgccccgcgggcttcagcgggatccactgt
gagaacaacacgcctgactgcacagagagctcctgcttcaacggcggcacctgcgtggac
ggcatcaactcgttcacctgcctgtgtccacccggcttcacgggcagctactgccagcac
gatgtcaacgagtgcgactcacagccctgcctgcacggcggcacctgccaggacggctgc
ggctcctacaggtgcacctgcccccagggctacaccggccccaactgccagaaccttgtg
cactggtgtgactcctcgccctgcaagaatggcggcaaatgctggcagacccacacccag
taccgctgtgagtgccccagtggctggaccggcctttactgcgacgtgcccagcgtgtcc
tgtgaggtggctgcgcagcgacaaggtgttgacgttgcccacctgtgccagcatggaggg
ctctgtgtggacgcgggcaacacgcaccactgccgctgccaggcgggctacacaggcagc
tactgtgaggacctggtggacgagtgctcacccagcccctgccagaacgggggcacctgc
acggactacctgggcggctactcctgcaagtgcgtggccggctaccacggggtgaactgc
tctgaggagatcgacgagtgcctgtcccacccctgccagaacgggggcacctgcctcgac
ctccccaacacctacaagtgctcctgcccacggggcacgcagggtgtgcactgtgagatc
aacgtggatgactgcaacccccccgttgaccccatgtcccggagccccaagtgctttaac
aatggcacctgcgtggaccaggtggggggctacagctgcacctgtccgccgggcttcgtg
ggtgagcgctgtgagggggatgtcaacgagtgcctgtccaatccctgcgacgcccgtggc
acccagaactgcgtgcagcgcgtcaacgacttccactgcgagtgccgtgccggtcacacc
gggcgccgctgcgagtccgtcatcaatggctgcaaaggcaagccctgcaagaatgggggc
acctgcgccgtggcctccaacaccgcccgcgggttcatctgcaagtgccctgcgggcttt
gagggcgccacgtgtgagaatgacgctcgtacctgcggcagcctgcgctgcctcaacggc
ggcacatgcatctccggcccacgcagccccacctgcctgtgcctgggccccttcacgggc
cccgaatgccagttcccggccagcagcccctgcctgggcggcaacccctgctacaaccag
gggacctgtgagcccacatccgagagccccttctaccgttgcctgtgccccgccaaattc
aatgggctcttgtgccacattctggactacagctttgggggcggggccgggcgcgacatc
cccccgccgctgatcgaggaggcgtgcgagctgcccgagtgccaggaggacgcgggcaac
aaggtctgcagcctgcagtgcaacaaccacgcgtgcggctgggacggcggcgactgctcc
ctcaacttcaatgatccctggaagaactgcacgcagtctctgcagtgctggaagtacttc
agtgacggccactgtgacagccagtgcaactcggctggctgcctcttcgacggcttcgac
tgccagcgcgcggaaggccagtgcaaccccctgtacgaccagtactgcaaggaccacttc
agcgatgggcactgcgatcagggctgcaacagtgcggagtgcgagtgggacgggctggac
tgtgcagagcatgtgcccgagaggctggcggccggcacgctggtggtggtggtgctgatg
ccgccggagcagctgcgcaacagctcctttcacttcctgcgggagctcagccgcgtgctg
cacaccaacgtggtcttcaagcgtgacgcacgcggccagcagatgatcttcccctactac
ggccgtgaggaggagctgcgcaagcaccccatcaagcgtgccgccgagggctgggccgca
cctgacgccctgctgggccaggtgaaggcctcgctgctccctgatggcagcgggggtggg
cggcggcggagggagctggaccccatggacgtccgcggctccatcgtctacctagagatt
gacaaccggcagtgtgtgcaggcatcctcgcagtgcttccagagtgccaccgacgtggcc
gcgttcctgggagcactcgcctcgctgggcagcctcaacatcccctacaagatcgaggct
gtgcagagtgagaccgtggagccgcccccgccggcgcagctgcacttcatgtacgtggca
gcggccgcctttgtgctgctgttcttcgtgggctgcggggtgctgctatcccgcaagcgc
cggcggcagcatggccaactctggttccctgagggcttcaaagtgtccgaggccagcaag
aagaaacggcgggaaccccttggcgaggactccgtgggcctcaagcccctgaagaacgcc
tcagacggtgccctcatggacgacaaccagaatgagtggggggacgaggacctggagacc
aagaagttccggttcgaggagcccgtggttctgcctgacctggacgaccagacagaccac
cggcagtggactcagcagcacctggatgctgctgacctgcgcatgtctgccatggccccc
acaccgccccagggtgaggttgacgccgactgcatggacgtcaatgtccgcgggcctgat
ggcttcaccccgctcatgatcgcctcctgcagcgggggcggcctggagacgggcaacagc
gaggaggaggaggacgcgccggctgtcatctccgacttcatctaccagggcgccagcctg
cacaaccagacagaccgcacgggcgagaccgccttgcacctggccgcccgctactcacgc
tctgatgccgccaagcgcctgctggaggccagcgcagacgccaacatccaggacaacatg
ggccgcaccccgctgcatgcggctgtgtctgccgacgcacaaggtgtcttccagatcctg
atccggaaccgagccacagacctggatgcccgcatgcatgacggcacgacgccgctgatc
ctggctgcccgcctggccgtggagggcatgctggaggacctcatcaactcacacgccgac
gtcaacgccgtggatgacctgggcaagtccgccctgcactgggccgccgccgtgaacaat
gtggatgccgcagttgtgctcctgaagaacggggctaacaaagacatgcagaacaacaag
gaggagacacccctgtttctggccgcccgggagggcagctacgagaccgccaaggtgctg
ctggaccactttgccaaccgggacatcacggatcatatggaccgcctgccacgcgacatc
gcacaggagcgcatgcaccatgacatcgtgaggctgctggacgagtacaacctggtgcgc
agcccgcagctgcacggagccccgctggggggcacgcccaccctgtcacccccgctctgc
tcgcccaacggctacctgggcagcctcaagcccagtgtgcagggcaagaaggtccgcaag
cccagcagcaaaggcctggcctgtggaagcaaggaggccaaggacctcaaggcacggagg
aagaagtcccaggacggcaaaggctgcctgctggacagctccggcatgctctcgcccgtg
gactccctggagtcaccccatggctacctgtcagacgtggcctcgccgccactgctgccc
tccccattccagcagtctccgtccgtgcccctcaaccacctgcctggtatgcccgacacc
cacctgggcatcgggcacctgaacgtggcggccaagcccgagatggcggcgctgggtggg
ggcggccggctggccttcgagaccggcccccctcgtctctctcacctgcctgtggcctcc
ggcaccagcaccgtcctgggctccggcagcggaggggccctgaatttcactgtgggtggg
tccaccagtttgaatggtcaatgcgagtggctgtcccggctgcagagtggcatggtgccg
aaccaatacaaccctctgcgggggagcgtggcaccaggccccctgagcacgcaggccccc
tccctgcagcatggcatggtgggtccgctgcacagtagccttgctgccagcgccctgtcc
cagatgatgagctaccagggcctgcccagcacccggctggccacccagcctcacctggtg
cagacccagcaggtgcagccacaaaacttacagatgcagcagcagaacctgcagccacca
aacatccagcagcagcaaagcctgcagccgccaccaccaccaccacagccacaccttggc
gtgagctcagcagccagcggccacctgagccggagcttcctgggtggagagccgagccag
gcagacgtgcagccactgggccccagcagcctggcggtgcacactattctgccccaggag
agccccgccctgcccacgtcgctgccatcctcgctggtcccacccgtaaccgcagcccag
ttcctgacgcccccctcgcagcacagctactcctcctcgcctgtggacaacacccccagc
caccagctacaggtgcctgagcaccccttcctcaccccgtcccctgagtcccctgaccag
tggtccagctcgtccccgcattccaacgtctccgactggtccgagggcgtctccagccct
cccaccagcatgcagtcccagatcgcccgcattccggaggccttcaagtaa

KEGG   Pongo abelii (Sumatran orangutan): 100454773
Entry
100454773         CDS       T01416                                 

Gene name
NOTCH3
Definition
(RefSeq) neurogenic locus notch homolog protein 3
  KO
K20995  Notch 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04330  Notch signaling pathway
pon04371  Apelin signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04919  Thyroid hormone signaling pathway
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05206  MicroRNAs in cancer
pon05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    100454773 (NOTCH3)
   04371 Apelin signaling pathway
    100454773 (NOTCH3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    100454773 (NOTCH3)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100454773 (NOTCH3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100454773 (NOTCH3)
   05206 MicroRNAs in cancer
    100454773 (NOTCH3)
  09162 Cancer: specific types
   05224 Breast cancer
    100454773 (NOTCH3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100454773 (NOTCH3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100454773 (NOTCH3)
SSDB
Motif
Pfam: EGF hEGF EGF_CA Ank_2 EGF_2 Notch Ank NODP Ank_5 NOD DUF3454 Ank_3 Ank_4 cEGF EGF_3
Other DBs
NCBI-GeneID: 100454773
NCBI-ProteinID: XP_002828866
Ensembl: ENSPPYG00000009668
UniProt: H2NXW0 A0A6D2WPQ2
LinkDB
Position
19
AA seq 2321 aa
MGPGARGRRRRRCPMSPPPPPPPVRALPLLLLLAGPGAAAPPCLDGSPCANGGRCTQLPS
REAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLP
DPCLSSPCAHGARCSVGPDGRFLCSCPPGYQGRSCRSDVDECRVGEPCRHGGTCLNTPGS
FRCQCPAGYTGPLCENPAVPCAPSPCRNGGTCRQSGDLTYDCACLPGFEGQNCEVNVDDC
PGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGGHSC
VCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNPC
HEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQCG
RGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCEVDIDECQSSPCVN
GGVCKDRVNGFSCTCPSGFSGSTCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGFEGT
LCERNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGTRCESQVDECRSQPCRHGGKCLDL
VDKYLCRCPSGTTGVNCEVNIDDCASNPCTFGVCRDGINRYDCVCQPGFTGPLCNVEINE
CASSPCGEGGSCVDGENGFRCLCPPGSLPPLCLPPSHPCAHEPCSHGICYDAPGGFRCVC
EPGWSGPRCSQSLARDACESQPCRAGGTCSSDGMGFHCTCPPGVQGRQCELLSPCTPNPC
EHGGRCESAPGQLPVCSCPQSWQGPRCQQDVDECAGPAPCGPHGICTNLAGSFSCTCHGG
YTGPSCDQDINDCDPNPCLNGGSCQDGVGSFSCSCLAGFAGPRCARDVDECLSNPCGPGT
CTDHVASFTCTCPPGYGGFHCEQDLPDCSPSSCFNGGTCVDGVNSFSCLCRPGYTGAHCQ
HEADPCLSRPCLHGGVCSAAHPGFRCTCPESFTGPQCQTLVDWCSRQPCQNGGRCVQTGA
YCLCPPGWSGRLCDIRSLPCREAAAQIGVRLEQLCQAGGQCVDEDSSHYCVCLEGRTGSH
CEQEVDPCLAQPCQHGGTCRGYMGGYMCECLPGYIGDNCEDDVDECASQPCQHGGSCIDL
VARYLCSCPPGTLGVLCEINEDDCGPGPPLDSGPRCLHNGTCVDLVGGFRCTCPPGYTGL
RCEADINECRSGACHAAHTRDCLQDPGGGFRCLCHAGFSGPRCQTVLSPCESQPCQHGGQ
CRPSPGPGGGLTFTCHCAQPFWGPRCERVARSCRELQCPVGVPCQQTPRGPRCTCPPGLS
GPSCRSFPGSPPGASNASCAAAPCLHGGSCRPAPLAPFYRCACAQGWTGPRCEAPAAAPE
VSEEPRCPRAACQAKRGDQRCDRECNSPGCGWDGGDCSLSVGDPWRQCEALQCWRLFNNS
RCDPACSSPACLYDNFDCHAGGRERTCNPVYEKYCADHFADGRCDQGCNTEECGWDGLDC
ASEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSAILRTSLRFRLDAHGQAMVFPYHR
PSPGSESRARRELAPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVERL
DFPYPLRDVRGEPLEPPEPSVPLLPLLLAGAVLLLVILVLGVMVARRKREHSTLWFPEGF
SLHKDVASGHKGRREPVGQDALGMKNMAKGESLMGEVATDWMDTECPEAKRLKVEEPGMG
AEEAVDCRQWTQHHLVAADIRVAPAMALTPPQGDADADGMDVNVRGPDGFTPLMLASFCG
GALEPMPTEEDEADDTSASIISDLICQGAQLGARTDRTGETALHLAARYARADAAKRLLD
AGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLDARMADGSTALILAARLAVEG
MVEELIASHADVNAVDELGKSALHWAAAVNNVEATLALLKNGANKDMQDTKEETPLFLAA
REGSYEAAKLLLDHFANREITDHLDRLPRDVAQERLHQDIVRLLDQPSGPRSPPGPHGLG
PLLCPPGAFLPGLKAAQSGSKKSRRPPGKAGLGPQGPRGRGKKLTLACPGPLADSSVTLS
PVDSLDSPRPFGGPPASPGGFPLEGPYAAATATAVSLAQLGGPGRAGLGRQPPGGCVLSL
GLLNPVAVPLDWARLPPPAPPGPSFLLPLAPGPQLLNPGTPVSPQERPPPYLAVPGHGEE
YPAAGAHSSPPKARFLRVPSEHPYLTPSPESPEHWASPSPPSLSDWSESTPSPATATGAM
ATTTGALPAQPFPLSVPSSLAQAQTQLGPQPEVTPKRQVLA
NT seq 6966 nt   +upstreamnt  +downstreamnt
atggggccgggggcccgtggccgccgccgccgccgttgcccgatgtcgccgccaccgcca
ccgccacccgtgcgggcgctgcccctgctgctgctgctagcggggccgggggctgcagcc
cctccttgcctggacggaagcccgtgtgcaaatggaggtcgttgcacccagctgccctcc
cgggaggctgcctgcctgtgcccacccggctgggtgggtgagcggtgtcaactggaggac
ccctgtcactcaggcccctgtgctggccgtggtgtctgccagagttcagtggtggctggc
accgcccgattctcatgccggtgcccccgtggcttccgaggccctgactgctccctgcca
gatccctgcctcagcagcccttgtgcccacggtgcccgctgctcagtggggcccgatgga
cgcttcctctgctcctgcccacctggctaccagggccgcagctgccgaagcgacgtggat
gagtgccgggtgggtgagccctgccgccatggtggcacctgcctcaacacgcctggctcc
ttccgctgccagtgtccagctggctacacggggccgctatgcgagaaccccgcggtaccc
tgtgcaccctcgccatgccgtaacgggggcacctgcaggcagagtggcgacctcacttat
gactgcgcctgtcttcctgggtttgagggtcagaattgtgaagtgaatgtggacgactgt
ccaggacaccgatgtctcaatggggggacatgcgtggatggcgtcaacacctataactgc
cagtgccctcctgagtggacaggccagttctgcacggaggacgtggatgagtgtcagctg
cagcccaacgcctgccacaatgggggtacctgcttcaacacgctgggtggccacagctgc
gtgtgtgtcaatggctggacaggcgagagctgcagtcagaatatcgatgactgtgccaca
gccgtgtgcttccatggggccacctgccatgaccgcgtggcttctttctactgtgcctgc
cccatgggcaagactggcctcctgtgtcacctggatgacgcctgtgtcagcaacccctgc
cacgaggatgctatctgtgacacaaatccggtgaacggccgggccatttgcacctgtcct
cccggcttcacgggtggggcgtgtgaccaggatgtggacgagtgctctatcggcgccaac
ccctgcgagcacttgggcaggtgcgtgaacacgcagggctccttcctgtgccagtgcggc
cgtggctacactggacctcgctgtgagaccgacgtcaacgagtgtctgtcggggccctgc
agaaaccaggccacgtgcctcgaccgcataggccagttcacctgtatctgtatggcaggc
ttcacaggaacctattgcgaggtggacattgacgagtgtcagagtagcccgtgtgtcaac
ggtggggtctgcaaggaccgagtcaatggcttcagctgcacctgcccctcaggcttcagt
ggctccacgtgtcagctggacgtggacgaatgcgccagtacgccctgcaggaatggcgcc
aagtgcgtggaccagcccgatggctacgagtgccgctgcgctgagggctttgagggcacg
ctgtgtgagcgcaacgtggacgactgctcgcctgacccatgccaccatggtcgctgcgtg
gatggcatcgccagcttctcatgtgcctgtgcccctggctacacgggcacacgctgcgag
agccaggtggacgaatgccgcagccagccctgccgccatggcggcaaatgcctagacctg
gtggacaagtacctctgccgctgcccttctgggaccacaggtgtgaactgcgaagtgaac
attgacgactgtgccagcaacccctgcacctttggagtctgccgtgatggtatcaaccgc
tacgactgtgtctgccaacctggcttcacagggcccctttgtaacgtggagatcaatgag
tgtgcttccagcccgtgcggcgagggaggttcctgtgtggatggggaaaacggctttcgc
tgcctctgcccgcctggctccttgcccccactctgcctcccaccgagccatccctgtgcc
catgaaccctgcagtcacggcatctgctatgatgcacctggcgggttccgctgtgtgtgt
gagcctggctggagtggcccccgctgcagccagagcctggcccgagatgcctgtgagtcc
cagccctgccgggccggtgggacatgcagcagcgatggaatgggtttccactgcacctgc
ccccctggtgtccagggacgtcagtgtgagctcctctccccctgcaccccgaacccctgt
gagcatgggggccgctgcgagtctgcccctggccagctgcctgtctgctcctgcccccag
agctggcaaggcccacgatgccagcaggatgtggacgagtgtgctggccccgcaccctgt
ggccctcatggtatctgcaccaacctggcagggagtttcagctgcacctgccatggaggg
tacactggcccttcctgcgatcaggacatcaatgactgtgaccccaacccatgcctgaac
ggtggctcgtgccaagacggcgtgggctccttttcctgctcctgcctcgctggtttcgcc
ggcccacgatgcgcccgcgacgtggacgagtgcctgagcaacccctgcggcccaggcacc
tgcaccgaccacgtggcctccttcacctgcacctgcccgccgggctatggaggcttccac
tgcgaacaggacctgcccgactgcagccccagctcctgcttcaatggcgggacctgtgtg
gacggcgtgaactcgttcagctgcctgtgccgtcccggctacacaggagcccactgccaa
catgaggcagacccctgcctctcgcggccctgcctgcacgggggcgtctgcagcgccgcc
caccctggcttccgctgcacctgccccgagagcttcacgggcccgcagtgccagacgctg
gtggattggtgcagccgccagccttgtcaaaacgggggtcgctgcgtccagactggggcc
tattgcctttgtccccctggatggagcggacgcctctgtgacatccgaagcttgccctgc
agggaggccgcagcccagatcggggtgcggctggagcagctgtgtcaggcgggtgggcag
tgtgtggatgaagacagctcccactactgcgtgtgcctagagggccgtactggtagccac
tgtgagcaggaggtggacccctgcttggcccagccctgccagcatggggggacctgccgt
ggctatatggggggctacatgtgtgagtgtcttcctggctacattggtgataactgtgag
gacgacgtggacgaatgtgcttcccagccctgccagcacgggggttcatgcattgacctc
gtggcccgctatctctgctcctgtcccccaggaacgctgggcgtgctctgcgagattaat
gaggatgactgcggcccaggcccccccctggactcagggccccggtgcctacacaatggc
acctgcgtggacctggtgggcggtttccgctgcacctgtcccccaggatacactggtttg
cgttgcgaggcagatatcaatgagtgtcgctcaggtgcctgccatgcagcacacacccgg
gactgcctgcaggacccaggcggaggtttccgttgtctttgtcatgctggcttctcaggt
cctcgctgtcagactgttctgtccccctgcgagtcgcagccatgccagcatggaggccag
tgccgtcctagcccgggtcctgggggggggttgaccttcacctgtcactgtgcccagcca
ttctggggtccgcgttgcgagcgggtggcgcgctcctgccgggagctgcagtgcccggtg
ggcgtcccatgccagcagacgccccgcgggccgcgctgcacctgccccccagggttgtcg
ggaccctcctgccgcagcttcccggggtcgccgccgggagccagcaacgccagctgcgcg
gccgccccctgtctccacgggggctcctgccgccccgcgcccctcgcgcccttctatcgc
tgcgcttgcgcgcagggctggaccgggccgcgctgcgaggcgcccgccgcggcacccgag
gtctcggaggagccgcggtgcccgcgcgccgcctgccaggccaagcgcggggaccagcgc
tgcgaccgcgagtgcaacagcccgggctgcggctgggacggcggcgactgctcgctgagc
gtgggcgacccctggcggcagtgcgaggcgctgcagtgctggcgcctcttcaacaacagc
cgctgcgaccccgcctgcagctcgcccgcctgcctctacgacaacttcgactgccatgcc
ggtggccgcgagcgcacttgcaacccagtgtacgagaagtactgcgccgaccactttgcc
gacggccgctgcgaccagggctgcaacacggaggagtgcggctgggatgggctagattgt
gccagcgaggtgccggccctgctggcccgcggcgtgctggtgctcacagtgctgctgccg
ccggaggagctactgcgttccagcgccgactttctgcagcggctcagcgccatcctgcgc
acctcgctgcgcttccgcctggacgcgcacggccaggccatggtcttcccttaccaccgg
cctagtcctggctccgaatcccgggcccgtcgggagctggcccccgaggtgatcggctcc
gtagtgatgctggagattgacaaccggctctgcctccagtcgcctgagaatgatcactgc
ttccccgatgcccagagcgccgctgactacctgggagcgctgtctgcggtggagcgcctg
gacttcccgtacccactgcgggacgtgcggggggagccgctggagcctccagaacccagc
gtcccgctgctgccgctgctactggcgggcgctgtcttgctgctggtcatcctcgtcctg
ggtgtcatggtggcccggcgcaagcgcgagcacagcaccctctggttccccgagggcttc
tcactgcacaaggacgtggcctctggtcacaagggccggcgggaacccgtgggccaagac
gcgctgggcatgaagaacatggccaagggtgagagcctgatgggggaggtggccacagac
tggatggacacagagtgcccagaggccaagcggttgaaggtagaggagccgggcatgggg
gctgaggaggctgtggattgccgtcagtggactcaacaccatctggttgctgctgacatc
cgcgtggcaccagccatggcactgacaccaccacagggagacgcagatgctgatggcatg
gatgtcaatgtgcgtggcccagatggcttcaccccactaatgctggcttccttctgtggg
ggagccctggagccaatgccaactgaagaggatgaggcagatgacacatcagctagcatc
atctccgacctgatctgccagggggctcagcttggggcacggactgaccgtactggcgag
actgctttgcacctggctgcccgttatgcccgtgctgacgcagccaagcggctgctggat
gctggggcagacaccaatgcccaggaccactcaggccgcactcctctgcacacagctgtc
acagctgatgcccagggtgtcttccagattctcatccgaaaccgctctacagacttggat
gcccgcatggcagatggctcaacggcactgatcctggcagcccgcctggcagtagagggc
atggtggaagagctcatcgccagccatgctgatgtcaatgctgtggatgagcttgggaaa
tcagccttacactgggctgcggccgtgaacaacgtggaagccactttggccctgctcaaa
aatggagccaataaggacatgcaagataccaaggaggagacccccctgttcctggccgcc
cgcgagggcagctatgaggctgccaagctgctgttggaccactttgccaaccgtgagatc
accgaccacctggacaggctgccgcgggacgtagcccaggagagactgcaccaggacatc
gtgcgcttgctggatcaacccagtgggcctcgcagcccccccggtccccacggcctgggg
cctctgctctgtcctccaggggccttcctccccggcctcaaagcggcacagtcggggtcc
aagaagagcaggaggccccccgggaaggcggggctggggccgcaggggccccgggggcgg
ggcaagaagctgacgctggcctgcccgggccccctggctgacagctcggtcacactgtcg
cccgtggactcgctggactccccgcggcctttcggtgggccccctgcttcccctggtggc
ttcccccttgaggggccctatgcagctgccactgccactgcagtgtctctggcacagctt
ggtggcccaggccgggcgggtctagggcgccagccccctggaggatgtgtactcagcctg
ggcctgctgaaccctgtggctgtccccctcgattgggcccggctgcccccacctgcccct
ccaggcccctcgttcctgctgccactggcaccaggaccccagctgctcaacccagggacc
cccgtctccccgcaggagcggcccccgccttacctggcagtcccaggacatggcgaggag
tacccggcggctggggcacatagcagccccccaaaggcccgcttcctgcgggttcccagt
gagcacccttacctgaccccatcccccgaatcccctgagcactgggccagcccctcgcct
ccctccctctcagactggtccgaatccacgcccagcccggccactgccaccggggccatg
gccaccaccactggggcactgcctgcccagccatttcccttgtctgttcccagctccctt
gctcaggcccagacccagctggggccccagccggaagttacccccaagaggcaagtgttg
gcctga

DBGET integrated database retrieval system