KEGG   Pongo abelii (Sumatran orangutan): 100436876
Entry
100436876         CDS       T01416                                 

Gene name
MLH1
Definition
(RefSeq) DNA mismatch repair protein Mlh1 isoform X1
  KO
K08734  DNA mismatch repair protein MLH1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01524  Platinum drug resistance
pon03430  Mismatch repair
pon03460  Fanconi anemia pathway
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05213  Endometrial cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    100436876 (MLH1)
   03460 Fanconi anemia pathway
    100436876 (MLH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100436876 (MLH1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100436876 (MLH1)
   05226 Gastric cancer
    100436876 (MLH1)
   05213 Endometrial cancer
    100436876 (MLH1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100436876 (MLH1)
DNA repair and recombination proteins [BR:pon03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     100436876 (MLH1)
SSDB
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c CAF1
Other DBs
NCBI-GeneID: 100436876
NCBI-ProteinID: XP_024100085
Ensembl: ENSPPYG00000014021
LinkDB
Position
3
AA seq 756 aa
MSFVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVIVKEGGLKLIQ
IQDNGTGIRKEDLDIVCERFTTSKLQSFEDLASISTYGFRGEALASISHVAHVTITTKTA
DGKCAYRASYSDGKLKAPPKPCAGNQGTQITVEDLFYNIATRRKALKNPNEEYGKILEVV
GRYSIHNAGISFTVKKQGETVADVRTLPNASTVDNIRSIFGNAVSRELIEIGCEDKTLAF
KMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISP
QNVDVNVHPTKHEVHFLHEESILERVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEMV
KSTTSLISSSTSGSSDKVYAHQMVRTDSREQKLDAFLQPLSKPLSSQPEAIVTEDKTDIS
SGRARQQDEEMLELPAPAEMAAKNQSLEGDTTKETSEMSEKRGPTSSNPRKRHREDSDVE
MVEDDSRKEMTAACTPRRRIINLTSVLSLQEEINERGHEVLREMLHNHSFVGCVNPQWAL
AQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESGWTEE
DGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEVGNLIGLPLLIDNYVPPLEGLPIFILRL
ATEVNWDEEKECFESLSKECAMFYSIRKQYISEESTLSGQQSEVPGSIPNSWKWTVEHIV
YKALRSHILPPKHFTEDGNILQLANLPDLYKVFERC
NT seq 2271 nt   +upstreamnt  +downstreamnt
atgtcgttcgtggcaggcgttattcggcggctggacgagacagtggtgaaccgcatcgcg
gcgggggaagttatccagcggccagctaatgctatcaaagagatgattgagaactgttta
gatgcaaaatccacgagtattcaagtgattgttaaagagggaggcctgaaattgattcag
atccaagacaacggcactgggatcaggaaagaagatctggatattgtatgtgaaaggttc
actactagtaaactgcagtcctttgaggatttagccagtatttctacctatggctttcga
ggtgaggctttggccagcataagccatgtggctcatgttactattacaacgaaaacagct
gatggaaagtgtgcgtacagagcaagttactcagatggaaaactgaaagctcctcctaaa
ccatgtgctggcaatcaagggacccagatcacggtggaggaccttttttacaacatagcc
acgaggagaaaagctttaaaaaatccaaatgaagaatatgggaaaattttggaagttgtt
ggcaggtattcaatacacaatgcaggcattagtttcacagttaaaaaacaaggagagaca
gtagccgatgttaggacactacccaatgcctcaaccgtggacaatattcgctccatcttt
ggaaatgctgttagtcgagaactgatagaaattggatgtgaggataaaaccctagccttc
aaaatgaatggttacatatccaatgcaaactactcagtgaagaagtgcatcttcttactc
ttcatcaaccatcgtctggtagaatcaacttccttgagaaaagccatagaaacagtgtat
gcagcctatttgcccaaaaacacacacccattcctgtacctcagtttagaaatcagtccc
cagaatgtggatgttaatgtgcaccccacaaagcatgaagttcacttcctgcacgaggag
agcatcctggagcgggtgcagcagcacatcgagagcaagctcctgggctccaattcctcc
aggatgtacttcacccagactttgctaccaggacttgctggcccctctggggagatggtt
aaatccacaacaagtctgatctcctcttctacttctggaagtagtgataaggtctatgcc
caccagatggttcgtacagattcccgggaacagaagcttgatgcatttctgcagcctctg
agcaaacccctgtccagtcagcccgaggccattgtcacagaggataagacagatatttct
agtggcagggctaggcagcaagatgaggagatgcttgaactcccagcccctgctgaaatg
gctgccaaaaatcagagcttggagggggatacaacaaaggagacttcagaaatgtcagag
aagagaggacccacttccagcaaccccagaaagagacatcgggaagattctgatgtggaa
atggtggaagatgattcccgaaaggaaatgactgcagcttgtaccccgcggagaaggatc
attaacctcactagtgttttgagtctccaggaagaaattaatgaacggggacatgaggtt
ctccgggagatgttgcataaccactccttcgtgggctgtgtgaatcctcagtgggccttg
gcacagcatcaaaccaagttataccttctcaacaccaccaagcttagtgaagaactgttc
taccagatactcatttatgattttgccaattttggtgttctgaggttatcggagccagca
ccgctctttgacctcgccatgcttgccttagatagtccagagagtggctggacagaggaa
gatggtcccaaagaaggacttgctgaatacattgttgagtttctgaagaagaaggctgag
atgcttgcagactatttctctttggaaattgatgaggtagggaacttgattggattaccc
cttctgattgacaactatgtgccccctttggaaggactgcctatcttcattcttcgacta
gccactgaggtgaattgggatgaagaaaaggaatgttttgaaagcctcagtaaagaatgt
gctatgttctactccatccggaagcagtacatatctgaggagtcgaccctctcaggccag
cagagtgaagtgcctggctccattccaaactcctggaagtggactgtggaacacattgtc
tataaagccttgcgctcacacattctgcctcctaaacatttcacagaagatggaaatatc
ctgcagcttgctaacctgcctgatctatacaaagtctttgagaggtgttaa

DBGET integrated database retrieval system