KEGG   Pongo abelii (Sumatran orangutan): 100436971
Entry
100436971         CDS       T01416                                 

Gene name
PHLPP1
Definition
(RefSeq) PH domain leucine-rich repeat-containing protein phosphatase 1
  KO
K16340  PH domain and leucine-rich repeat-containing protein phosphatase [EC:3.1.3.16]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100436971 (PHLPP1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100436971 (PHLPP1)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100436971 (PHLPP1)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    100436971 (PHLPP1)
SSDB
Motif
Pfam: LRR_8 PP2C LRR_4 LRR_6 PH SUIM_assoc
Other DBs
NCBI-GeneID: 100436971
NCBI-ProteinID: XP_002828320
Ensembl: ENSPPYG00000009209
UniProt: H2NWH3
LinkDB
Position
18
AA seq 1707 aa
MEPAAAATAQRLPEPGREDLASAPAAAAAALAAAAGGGRSPEPALTPAAPSGGNGSGGGA
REEAPGEAPPGPLPGRAGGAGRRRRRGAPQPIAGGAAPVPGAGGGANSLLLRRGRLKRNL
SAAASSSSSSSAAAASHSPGAAGLPASCSASASLCTRSLDRKTLLLKHRQTLQLQPSDRD
WVRHQLQRGCVHIFDRHMASTYLRPVLCTLDTTAGEVAARLLQLGHKGGGVVKVLGQGPG
AAAAREPAEPPPEAGPRLAPPEPQDSEVQPARSAPGAVGGPPRAPPADLPLPAGGPGRWS
RRASPAPSDSSPGEPFVGGPASSPRAPRPVASDTESFSLSPSAESVSDRLDPYSSGGGGS
SSSSEELEADAVSAPTGVPGQPRRPGHPAQPLPPPQTASSPRPQQKAPRAIDSPGGAVRE
GSCEEKAAAAVAPGGLQSTPGRSGVTAEKAPPPPPPPTLYVQLHGETTRRLEAEEKPLQI
QNDYLFQLGFGELWRVQEEGMDSEIGCLIRFYAGKPHSTGSSERIQLSGMYNVRKGKMQL
PVNRWTRRQVILCGTCLIVSSVKDSLTGKMHVLPLIGGKVEEVKKHQHCLAFSSSGPQSQ
TYYICFDTFTEYLRWLRQVSKVASQRISSVDLSCCSLEHLPANLFYSQDLTHLNLKQNFL
RQNPSLPAVRGLNELQRFTKLKSLNLSNNHLGDFPLAVCSIPTLAELNVSCNALRSVPSA
VGVMHNLQTFLLDGNFLQSLPAELENMKQLSYLGLSFNEFTDIPEVLEKLTAVDKLCMSG
NCMETLRLQALRKMPHIKHVDLRLNVIRKLIADEVDFLQHVTQLDLRDNKLGDLDAMIFN
NIEVLHCERNQLVTLDICGYFLKALYASSNELVQLDVYPVPNYLSYMDVSRNRLENVPEW
VCESRKLEVLDIGYNQICELPARLFCNSSLRKLLAGHNQLARLPERLERTSVEVLDVQHN
QLLELPPNLLMKADSLRFLNASANKLESLPPATLSEETNSILQELYLTNNSLTDKCVPLL
TGHPHLKILHMAYNRLQSFPASKMAKLEELEEIDLSGNKLKAIPTTIMNCRRMHTVIAHS
NCIEVFPEVMQLPEIKCVDLSCNELSEVTLPENLPPKLQELDLTGNPRLVLDHKTLELLN
NIRCFKIDQPSTGDASGAPAVWSHGYTEASGVKNKLCVAALSVNNFCDNREALYGVFDGD
RNVEVPYLLQCTMSDILAEELQKTKNEEEYMVNTFIVMQRKLGTAGQKLGGAAVLCHIKH
DPVDPGGSFTLTSANVGKCQTVLCRNGKPLPLSRSYIMSCEEELKRIKQHKAIITEDGKV
NGVTESTRILGYTFLHPSVVPRPHVQSVLLTPQDEFFILGSKGLWDSLSVEEAVEAVRNV
PDALAAAKKLCTLAQSYGCHDSISAVVVQLSVTEDSFCCCELSASGAAPPPSPGLFPPSV
SMVIKDRPSDGLGVPSSSSGMASEISSELSASEMSSEVGSTASDEPPPGALSENSPAYPS
EQRCMLHPVCLSNSFQRQLSSATFSSAFSDNGLDSDDEEPIEGVFTNGSRVEVEVDIHCS
RAKEKEKQQHLLQVPAEASDEGIVISANEDEPGLPRKADFSAVGTIGRRRANGSVAPQER
SHNVIEVATDAPLRKPGGYFAAPAQPDPDDQFIIPPELEEEVKEIMKHHQEQQQQQQQQL
PPPPQLQPQLPRHYQLDQLPDYYDTPL
NT seq 5124 nt   +upstreamnt  +downstreamnt
atggagcccgccgccgcggccacggcacagcgactccccgagcccggcagggaggaccta
gcttcggctccggcggccgccgctgcggctctggcggcggcggccgggggcggccggagt
ccggagcccgcgctgaccccggcggccccgagcggcgggaacggcagcggcggcggggcg
cgggaagaggccccgggcgaggcgccgccggggccgctgccgggcagagcagggggtgcc
gggcgcaggaggcggcgcggggcgccccagcccattgccggcggggctgcccccgtaccc
ggagccggcggcggcgccaactccctcctgctgaggagagggcggctgaagaggaatctg
tccgcggccgcctcgtcgtcgtcgtcgtcctcggccgctgctgcctcgcactcccccggc
gctgctggcctccccgcctcctgctcggcctcggcgtcgctgtgcacccggagcctggac
aggaagacgctgctcctgaagcaccggcagacgctgcagctgcagccgtcggaccgggac
tgggtgaggcaccagctccagcgcggctgcgtgcatatcttcgaccgccacatggcctcg
acctacctgcgcccggtgctctgcacactggacaccacggccggcgaggtggccgcccgc
ctgctgcagctgggacacaaaggcggcggcgtggtgaaggtgctgggccaggggcccgga
gccgccgccgcccgggagcccgctgagccgccccccgaggccggcccccggctggcgccc
ccggagccgcaggactcggaggtacagcccgcgaggagcgcgccgggtgccgtcgggggt
cctccgcgcgcgccccccgccgacctacccctgcccgccggcggcccgggcaggtggtcg
cgccgcgccagcccagcgccctcggactccagcccgggcgagccgttcgttgggggccct
gcctcttcgccccgcgccccgcggcctgtggcctccgacaccgagagcttcagcctgagt
cccagcgccgagagcgtgtctgaccggctggacccctacagcagcggcggcggcggctcc
tcgtcgtcgtcggaagagctcgaggccgacgcagtctcggccccgacgggggtcccgggc
cagccccgccgtcccggccaccccgcgcagcccctcccgcctccccagacggcttcctcc
cctcggccgcagcagaaagccccgagggccattgacagtccgggcggggccgtccgcgag
gggtcgtgcgaggagaaggcggcggccgccgtggccccgggaggcctccagtcgaccccc
gggaggagcggggtgaccgcggagaaagcgcctccgccgcccccgccgcccaccctgtac
gtgcagctccacggagagaccacccggcgcttggaggcggaggagaagccattgcagatc
caaaatgactacctcttccaactgggatttggggagctgtggagggtgcaggaggaaggc
atggactcggagattggctgcctcatccgcttctatgcaggaaaacctcacagcacgggt
agctctgaacggattcagctctcaggaatgtataatgtccgtaaaggcaagatgcagttg
ccagtgaaccgatggacaagacgccaagtcatcctatgtgggacctgcctgatagtatca
tctgtgaaagacagcttgaccggaaagatgcatgttctgccactaattggtggaaaagta
gaagaagtgaaaaagcaccaacactgtttagcatttagctcctctggaccccaaagccag
acttactacatttgctttgatactttcacagaatacttaaggtggctgcgtcaagtctcc
aaggttgcatcccagcgcattagctcagtggacctctcatgttgtagcctggaacatctg
cctgccaacctcttctacagccaagacctcactcatctgaatttaaaacaaaacttccta
aggcaaaaccctagccttccagctgtcagggggcttaatgaactgcaaaggttcaccaag
ttgaagagtcttaacctttccaataatcatttaggggacttcccactggcagtctgcagt
attccaaccctggcagagctgaacgtgtcctgcaatgccctgcgatcagtcccgtcagcc
gttggagtgatgcacaacttacagacatttttgttggatggaaactttctccaatccctt
cctgctgagttggagaacatgaagcagcttagttatctgggtctttctttcaatgaattt
actgacattcccgaagtattggagaaattgactgctgtggataaactttgtatgtccgga
aactgtatggagacccttaggctacaggctttaagaaaaatgcctcacattaaacatgtg
gatctaaggttgaacgtaattaggaagctgatagcagatgaagtggactttctacagcat
gttactcagcttgacctacgagacaataagcttggtgatctagatgccatgattttcaac
aacattgaagttttacactgtgaaaggaatcaactggtcacattagacatctgtggctat
ttcctaaaagcactctatgcctcttctaatgaacttgttcaacttgatgtttacccagtt
ccaaattatctgtcctacatggatgtttcaaggaaccgtttagaaaatgtgcctgagtgg
gtatgtgaaagccgaaagctagaagttttggatattggctataatcaaatatgtgaactt
cctgcccgcttattttgtaatagcagtctccggaaactactggcaggacacaaccagttg
gcaaggctgcctgaaaggctagaaagaacctcagtggaggtcttggatgtgcaacacaac
cagctccttgagctcccgcctaaccttctgatgaaggctgacagcctgagattcctgaat
gcatctgcgaacaaattggaaagccttcctccagccacgctttccgaagagacaaacagt
atcttacaagagttgtatttgacaaataacagcctcacagacaaatgtgtgcccttgtta
acgggacacccccatttgaagatccttcacatggcctataaccgacttcagagttttcca
gcaagtaaaatggcgaaactggaggaacttgaagaaattgatctcagtgggaataagctg
aaagccatccctacaacgatcatgaattgcaggcgcatgcacaccgtgattgctcactcc
aactgcatcgaggtctttcccgaagttatgcagctcccagagatcaagtgtgtggacctg
agctgtaatgagctaagcgaagtcacattaccagaaaacctgcctcccaaactgcaggag
ctagacctgactggaaaccctcgccttgtccttgatcacaaaaccctggaactactgaat
aatatccgctgtttcaagattgatcagccttctacaggagacgcttccggagccccagct
gtatggagtcatggttacactgaagcttcgggggtaaaaaacaagttgtgtgtcgcagcc
ctgtcagtgaataacttctgtgacaaccgcgaagccctgtatggtgtgtttgatggagac
cggaatgtggaggtgccctaccttctccagtgcactatgagtgacattttggctgaagag
ctgcaaaaaacaaaaaatgaagaagaatacatggtcaatacgttcattgtcatgcaaagg
aaacttggaactgctgggcagaagcttggcggtgccgctgtcctttgtcatatcaagcat
gaccctgtggacccaggaggatccttcaccttgacctctgctaatgtgggcaagtgccaa
acagttctctgtcgaaatggaaaaccgctgcctctgtccagatcttacatcatgagctgt
gaagaagagctgaagaggattaaacagcacaaggccattatcactgaggatggcaaggtg
aacggagtgactgagtccacgcgtatcctgggctacaccttcctccatcccagtgtggtg
cctcgtccccacgtgcagtccgtgctcctgaccccccaggatgagttcttcatcctaggc
agtaaggggttgtgggacagcctgtccgtcgaggaggccgtggaggccgtgcgcaacgtg
cccgacgccctggctgctgccaagaagctgtgtaccctggcccagagctacggctgccac
gacagcatcagcgctgtggtggtgcagctcagtgtcactgaggacagcttctgctgctgc
gagctcagcgccagtggggctgcgccaccacccagtcctggcctcttccctccctcagtg
agcatggtgatcaaggatcggccctcagatgggctgggcgtgccgtcctccagcagcggc
atggcttccgagattagcagcgagctctccgcttctgagatgagcagtgaggtggggtca
acggcctccgatgagcccccgcccggagccctaagcgagaacagccctgcctaccccagt
gagcagcgctgcatgctccaccccgtctgtctgtccaactccttccagcgccagctatct
agcgccacattctctagcgccttctccgacaatggccttgacagtgacgatgaggagccc
atcgagggcgtcttcaccaatggcagccgggtggaggtggaggtggacatccactgcagc
cgggccaaggagaaggagaaacagcagcacctgcttcaggtgccagcagaggccagcgat
gagggcattgtcatcagcgccaacgaggatgagccaggtctgcccaggaaggcagacttc
tctgccgttgggaccattgggcgccggagggccaatggctctgttgcgccccaggaaagg
agccacaatgtgatagaggtggctacagatgcacctcttcgaaagcctggaggctatttt
gctgccccggctcagccggatcccgatgatcagtttatcatacccccggagctggaagag
gaggtcaaagaaatcatgaagcatcaccaggagcaacagcagcagcagcagcagcagctg
ccaccaccccctcagctccagccgcagctgccgcggcactaccagctggaccagctgcca
gattattacgacacaccactatga

KEGG   Pongo abelii (Sumatran orangutan): 100445641
Entry
100445641         CDS       T01416                                 

Gene name
PHLPP2
Definition
(RefSeq) PH domain leucine-rich repeat-containing protein phosphatase 2 isoform X1
  KO
K16340  PH domain and leucine-rich repeat-containing protein phosphatase [EC:3.1.3.16]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100445641 (PHLPP2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100445641 (PHLPP2)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     100445641 (PHLPP2)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    100445641 (PHLPP2)
SSDB
Motif
Pfam: LRR_8 LRR_4 PP2C LRR_6 PH
Other DBs
NCBI-GeneID: 100445641
NCBI-ProteinID: XP_002826652
Ensembl: ENSPPYG00000007526
UniProt: H2NRE8
LinkDB
Position
16
AA seq 1358 aa
MGEVEPGPAGPLDPPEPPEAPASRRPGGIRFLKRNMKRNGSRNCLNRRSRFGSRERDWLR
EDVKRGCVYLYGADTTTATTTTTTSSSTSSSSSSSDLHLVLCTVETPASEICAGEGRESL
YLQLHGDLVRRLEPTERPLQIVYDYLSRLGFDDPVRIQEEATNPDLGCMIRFYGEKPCHM
DHLDRILLSGIYNVRKGKTQLHKWAERLVVLCGTCLIVSSVKDCQTGKMHILPLVGGKIE
EVKRRQYSLAFSSAGAQAQTYHVSFETLAEYQRWQRQASKVVSQRISTVDLSCYSLEEVP
EHLFYSQDITYLNLRHNFMQLERPGGLDTLYKFSQLKGLNLSHNKLGLFPILLCEISTLT
ELNVSCNGFRDLPSQIGNLLNLQTLCLDGNFLTTLPEELGNLQQLSSLGISFNNFSQIPE
VYEKLTMLDRVVMAGNCLEVLNLGVLNRMNHIKHVDLRMNHLKTMVIENLEGNKHITHVD
LRDNRLTDLDLSSLCSLEQLHCGRNQLRELTLSGFSLRTLYASSNRLTAVNIYPVPSLLT
SLDLSRNLLECVPDWACEAKKIEVLDVSYNLLTEVPMRILSSLSLRKLMLGHNHMQNLPT
LIEHIPLEVLDLQHNALTRLPDTLFSKALNLRYLNASANSLESLPSACTGEESLSMLQLL
YLTNNLLTDQCIPVLVGHLHLRILHLANNQLQTFPASKLNKLEQLEELNLSGNKLKTIPT
TIANCKRLHTLVAHSNNISIFPEILQLPQIQFVDLSCNDLTEILIPEALPATLQDLDLTG
NTNLVLEHKTLDIFSHITTLKIDQKPLPTTDSTVMSTFWSHGLAEMAGQRNKLCVSALAM
DNFAEGVGAVYGMFDGDRNEELPRLLQCTMADVLLEEVQQSTNDTVFMANTFLVSHRKLG
MAGQKLGSSALLCYIRPDTADPASSFSLTVANVGTCQAVLCRGGKPVPLSKVFSLEQDPE
EAQRVKDQKAIITEDNKVNGVTCCTRMLGCTYLYPWILPKPHISSTPLTIQDELLILGNK
ALWEHLSYTEAVNAVRHVQDPLAAAKKLCTLAQSYGCQDNVGAMVVYLNIGEEGCTCEMN
GLTLPGPVGFASTTTIKDAPKPATPSSSSGIASEFSSEMSTSEVSSEVGSTASDEHTTGG
LDAALLPRPERRCSLHPTPTSGLFQRQPSCATFSSNQSDNGLDSDDDQPVEGVITNGSKV
EVEVDIHCCRGRDLENSPPLIESSPTPCSEEHARGSCFGIRRQNSVNSGILLPMSKDRME
LQKSPSTSCLYGKKLSNGSIVPLEDSLNLIEVATEVPKRKTGYFAAPTQMEPEDQFVVPR
DLEEEVKEQMKQHQDSRLEPEPHEEDRTEPLEEFDTAL
NT seq 4077 nt   +upstreamnt  +downstreamnt
atgggggaggtggagccagggcccgcgggcccgctggatcccccggagccgcccgaagcg
cccgcgagccgccggccgggagggatccggttcctgaagagaaatatgaaacgcaatggg
agcagaaattgtttgaataggagaagtaggtttggttctcgagaaagagactggctaaga
gaagatgtaaagagaggctgtgtttacctttatggagcagacactaccactgccactaca
accaccaccacctcctcttccacttcctcctcctcctcttcctctgacttacatctcgtc
ctttgcactgtagagacaccagcatcagaaatatgtgctggagagggaagagaaagtctt
tatttgcaacttcatggagacctggtcaggagactggaacctactgaacgacctcttcag
atcgtttatgattacttatccaggctgggatttgatgatcctgtgcgcatacaggaggag
gctacaaatcctgacctcggctgtatgattcgattttatggtgaaaaaccgtgccacatg
gatcatttggatcgaatcctactgtctggcatctataatgtacgcaagggaaagacccag
ctgcataagtgggctgagcgcctagttgtcctctgtggtacctgccttattgtttcctca
gtgaaggattgtcaaactggaaagatgcacattttgcctctggttggtggaaagatagaa
gaagtgaagcgacggcagtactcccttgctttcagctcagcaggagcccaagctcagacc
tatcatgtcagcttcgagactttggccgagtaccagcgatggcaacggcaagcatccaag
gtggtgtcccagcgaatcagtaccgtggatctctcatgttacagcctcgaggaggttcct
gagcatctcttctatagtcaagatattacctacctcaacttgcgacacaacttcatgcag
ttagaaagacccggaggcctcgatacactctacaaattttctcaactgaagggcctgaac
ttgtcccataataaacttgggttgtttcctatattgttatgcgagatctctaccctgact
gagctcaacgtttcctgtaatggatttcgtgacctaccaagtcaaattggcaatctgcta
aatcttcaaaccctctgtcttgatggcaactttctgactactttacctgaagaattggga
aatctacaacagctttcctccttgggaatttccttcaacaactttagtcaaattcctgag
gtttatgagaaactcactatgttagatagagtggttatggcaggaaattgcctggaagtc
ctgaacttaggggtgctgaataggatgaaccatatcaagcatgtggatttaaggatgaac
catttgaaaaccatggttattgaaaatctggagggaaataaacacatcacccacgtggat
ctgcgggacaaccgactgactgacttggatcttagctccttatgcagcttggaacagctg
cactgtgggcggaatcagctgagggagctaacactcagtggcttctcccttcggaccctc
tatgccagttccaacaggctgacagcagtgaacatttatccagtacccagcctgcttact
tccttggatctctcccgaaacctgctagagtgtgtccctgactgggcctgtgaagcaaag
aagatagaagtattagatgtgagctataatcttctcacagaggttcccatgagaattctg
agtagcttgagtcttagaaaactgatgctgggacacaatcacatgcaaaacctcccaaca
ctgatagagcacatcccccttgaggtgttggatcttcagcataatgcactcacgaggctg
ccagacactctcttctccaaggccttaaatctcagatacttgaatgcatctgcaaatagt
ctggagtctttaccatccgcctgcactggagaggagagtttgagtatgctgcagctgctt
tatctgaccaacaatctcctgacggatcagtgcatacctgtcctggtagggcacctgcac
ctgcgaatcttgcaccttgcaaacaatcagttacagacctttcctgcaagcaaactaaat
aaattggagcaattggaggaactgaacctaagtggcaacaaacttaaaaccattcccaca
accatagcaaactgcaaaaggctgcacacccttgttgcacactccaacaacatcagcatt
ttcccagaaatactgcagttgcctcagatccagtttgtagacctaagttgcaacgacttg
acagaaatcctgattccagaggctttgcctgctacattacaagaccttgacctgactgga
aatacaaatctggttctggaacacaagacactggacatatttagccatatcacaaccctg
aaaattgatcagaaacctttgccaaccacagattctacagttatgtcaaccttctggagc
catggactggctgagatggcagggcagagaaataagctgtgtgtctcagcacttgctatg
gataactttgcagagggggtgggagctgtgtatggcatgtttgatggagaccgaaatgag
gagctcccgcgcctgctgcagtgtacgatggcagatgtgcttttagaagaggtacagcag
tcaactaatgacacagttttcatggctaacaccttcttggtatctcacaggaaattagga
atggctggccagaagttgggctcctccgctctcctgtgctacatccgccctgacactgcc
gatccagcaagtagctttagcttgactgtagccaatgttggcacgtgccaagcagtcctg
tgccgaggtgggaagccagtgcccctctctaaagtcttcagcctggagcaggacccagag
gaggcgcaaagggtgaaggaccaaaaagccatcatcacagaggacaacaaagtgaatggg
gtaacctgctgtacccggatgctgggctgtacatacctctacccttggatcctccccaag
ccccacatatcttccactccactgaccattcaagatgagttgctgattctgggaaacaaa
gcattgtgggaacacttgtcctacacggaagctgtcaatgctgtacgtcatgtacaagac
ccattagcagctgctaagaagctgtgcacattagcgcagagctatggctgtcaggacaat
gtaggggcgatggtggtttatttgaatattggtgaggaaggctgcacttgtgaaatgaat
gggctcaccctcccaggtcctgtgggatttgcttcaaccaccactatcaaggatgcccct
aagccagccactccatcctctagcagtgggattgcctctgagttcagtagtgagatgtcc
acctcagaggtgagcagtgaagtggggtccactgcttctgatgagcatactactgggggc
ctggacgctgccttgcttccgaggccagagcggcgctgcagcctccacccaacacccacc
tctgggctgtttcagcgccagccttcttgtgctactttctccagtaaccagtctgacaac
ggcctggacagtgatgatgaccagcccgttgagggggtcataaccaatggcagcaaggta
gaggtggaagtagacatccactgctgcagggggagggatctggagaactcaccccctctc
atagagagttctcctaccccgtgttctgaggaacatgctagagggtcgtgttttgggatc
cgaagacagaacagtgtgaatagtggcatactcctgccaatgagcaaggacaggatggag
ttacagaagtctccctccacctcctgcctctatgggaagaaactctccaatggctctatt
gtgcccctagaggacagcctgaacctcattgaagtggccacagaagtgcccaagaggaaa
actggctattttgctgcccccactcagatggaaccagaggaccagtttgttgtgcctcgt
gacctggaagaagaagtgaaggaacaaatgaaacagcaccaggacagccggctcgagcct
gagccccacgaagaggatcggaccgagcccctggaggagtttgacacagcactatga

DBGET integrated database retrieval system