KEGG   Pongo abelii (Sumatran orangutan): 100436978
Entry
100436978         CDS       T01416                                 

Gene name
DNMT1
Definition
(RefSeq) DNA (cytosine-5)-methyltransferase 1 isoform X1
  KO
K00558  DNA (cytosine-5)-methyltransferase 1 [EC:2.1.1.37]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00270  Cysteine and methionine metabolism
pon01100  Metabolic pathways
pon05206  MicroRNAs in cancer
Module
pon_M00035  Methionine degradation
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    100436978 (DNMT1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100436978 (DNMT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100436978 (DNMT1)
   03032 DNA replication proteins [BR:pon03032]
    100436978 (DNMT1)
   03036 Chromosome and associated proteins [BR:pon03036]
    100436978 (DNMT1)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:pon02048]
    100436978 (DNMT1)
Enzymes [BR:pon01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     100436978 (DNMT1)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Zinc finger
   CXXC CpG-binding proteins
    100436978 (DNMT1)
DNA replication proteins [BR:pon03032]
 Eukaryotic type
  DNA Replication Termination Factors
   DNA methylation enzymes
    100436978 (DNMT1)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100436978 (DNMT1)
Prokaryotic defense system [BR:pon02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   DNA methyltransferases
    100436978 (DNMT1)
SSDB
Motif
Pfam: BAH DNMT1-RFD DNA_methylase DMAP_binding zf-CXXC HTH_12
Other DBs
NCBI-GeneID: 100436978
NCBI-ProteinID: XP_024093741
LinkDB
Position
19
AA seq 1678 aa
MSGSVPSFCTGYRLSPFGTSPSPPRPDWGGRRRLRSSPLPIGFRAKSRGACAAAAASAEA
SEMPARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHEFLQTEIK
NQLCDLETKLRKEELSEEGYLAKVKSLLNKDLSLENGAHACNREVNGRLENGNQARSEVR
RVGMADANSPPKPLSKPRTPRRSKSDGEAKPEPSPSPRITRKSTRQTTITTHFAKGPAKR
KPQEESERAKSDESIKEEDKDQDEKRRRVTSKERVARPLPAEEPERAKPGTRTEKEEERD
EKEEKRLRSQTKEPTPKQKLKEEPDREARAGVHADEDEDGDEKDEKKHRSQPKDLAAKRR
PEEKEPEKVNPQISDEKDEDEKEEKRRKTTPKEPTEKKMARAKTVVNSKTHPPKCIQCGQ
YLDDPDLKYGQHPPDAVDEPQMLTNEKLSIFDANESGFESYEALPQHKLTCFSVYCKHGH
LCPIDTGLIEKNIELFFSGSAKPIYDDDPSLEGGVNGKNLGPINEWWITGFDGGEKALIG
FSTSFAEYILMDPSPEYAPIFGLMQEKIYISKIVVEFLQSNSDSTYEDLINKIETTVPPS
GLNLNRFTEDSLLRHAQFVVEQVESYDEAGDSDEQPIFLTPCMRDLIKLAGVTLGQRRAQ
ARRQTIRHSTREKDRGPTKATTTKLVYQIFDTFFAEQIEKDDREDKENAFKRRRCGVCEV
CQQPECGKCKACKDMVKFGGSGRSKQACQERRCPNMAMKEADDDEEVDDNIPEMPSPKKM
HQGKKKKQNKNRISWVGEAVKTDGKKSYYKKVCIDAETLEVGDCVSVIPDDSSKPLYLAR
VTALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKA
PSENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCAR
LAEMRQKEIPRVLEQLEDLDSRVLYYSATKNGILYRVGDGVYLPPEAFTFNIKLSSPVKR
PRKEPVDEDLYPEHYRKYSDYIKGSNLDAPEPYRIGRIKEIFCPKKSNGRPNETDIKIRV
NKFYRPENTHKSTPASYHADINLLYWSDEEAVVDFKAVQGRCTVEYGEDLPECVQVYSMG
GPDRFYFLEAYNAKTKSFEDPPNHARSPGNKGKGKGKGKGKPKSQACEPSEPEIEIKLPK
LRTLDVFSGCGGLSEGFHQAGISDTLWAIEMWDPAAQAFRLNNPGSTVFTEDCNILLKLV
MAGETTNSRGQRLPQKGDVEMLCGGPPCQGFSGMNRFNSRTYSKFKNSLVVSFLSYCDYY
RPRFFLLENVRNFVSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAA
APGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVR
NGASALEISYNGEPQSWFQRQLRGAQYQPILRDHICKDMSALVAARMRHIPLAPGSDWRD
LPNIEVRLSDGTMARKLRYTHHDRKNGRSSSGALRGVCSCVEAGKACDPAARQFNTLIPW
CLPHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARSQG
FPDTYRLFGNILDKHRQVGNAVPPPLAKAIGLEIKLCMLAKARESASAKIKEEEAAKD
NT seq 5037 nt   +upstreamnt  +downstreamnt
atgtccggctccgttccatccttctgcacagggtatcgcctctctccgtttggtacctcc
ccttctcccccacgcccggactggggtggtagacgccgcctccgctcatcgcccctcccc
atcggtttccgcgcgaaaagccggggcgcctgcgctgccgccgccgcgtctgctgaagcc
tccgagatgccggcgcgtaccgccccagcccgggtgcccacactggccgtcccggccatc
tcgctgcccgacgatgtccgcaggcggctcaaagatttggaaagagacagcttaacagaa
aaggaatgtgtgaaggagaaattgaatctcttgcacgaatttctgcaaacagaaataaag
aatcagttatgtgacttggaaaccaaattacgtaaagaagaattatccgaggagggctac
ctggctaaagtcaaatcccttttaaataaagatttgtccttggagaatggtgctcatgct
tgcaaccgggaagtgaatggacgtctagaaaacgggaaccaagcaagaagtgaagtccgt
agagtgggaatggcagatgccaacagcccccccaagcccctttccaaacctcgcacgccc
aggaggagcaagtccgatggagaggctaagcctgaaccttcacctagccccaggattaca
aggaaaagcaccaggcaaaccaccatcacaactcattttgcaaagggccctgccaaacgg
aaacctcaggaagagtctgaaagagccaaatcggatgagtccatcaaggaagaagacaaa
gaccaggatgagaagagacgtagagttacatccaaagaacgagttgctagaccacttcct
gcagaagaacctgaaagagcaaaaccaggaacacgcactgaaaaggaagaagaaagagat
gaaaaagaagaaaagagactccgaagtcaaaccaaagaaccaacacccaaacaaaaactg
aaggaggagccggacagagaagccagggcaggcgtgcacgctgatgaggacgaagacgga
gacgagaaagatgagaagaagcacagaagtcaacccaaagatctagctgccaaacggagg
cccgaagaaaaagaacctgaaaaagtaaatccacagatttctgatgaaaaagatgaggat
gaaaaggaggagaagagacgcaaaacgacccccaaagaaccaacggagaaaaaaatggct
cgcgccaaaacagtcgtgaactccaagacccaccctcccaagtgcattcagtgcgggcag
tacctggacgaccctgacctcaaatatgggcagcacccaccagacgcggtggatgagcca
cagatgctgacaaatgagaagctgtccatctttgacgccaacgagtctggctttgagagt
tatgaggcacttccccagcacaaactgacctgcttcagtgtgtactgtaagcatggtcac
ctgtgtcccatcgacaccggcctcatcgagaagaatatcgaactcttcttttctggttca
gcaaaaccaatctatgatgatgacccatctcttgaaggtggtgttaatggcaaaaatctt
ggccccataaatgaatggtggatcactggctttgatggaggtgaaaaggccctcatcggc
ttcagcacctcatttgctgaatacattctgatggatcccagtcccgagtacgcgcccata
tttgggctgatgcaggagaagatctacatcagcaagattgtggtggagttcctgcagagc
aattccgactcgacctacgaggacctgatcaacaagatcgagaccacggttcctccttct
ggcctcaacttgaaccgcttcacagaggactccctcctgcgacatgcgcagtttgtggtg
gagcaggtggagagttatgacgaggccggggacagtgacgagcagcccatcttcctgacg
ccctgcatgcgggacctgatcaagctggctggggtcacgctgggacagaggcgagcccag
gcgaggcggcagaccatcaggcattctaccagggagaaggacaggggacccacgaaagcc
accaccaccaagctggtctaccagatcttcgatactttcttcgcagagcaaattgaaaag
gatgacagagaagacaaggagaacgcctttaagcgccggcgatgtggcgtctgtgaggtg
tgtcagcagcctgagtgtgggaaatgtaaagcctgcaaggacatggttaaatttggtggc
agtggacggagcaagcaggcttgccaagagcggaggtgtcccaatatggccatgaaggag
gcagatgacgatgaggaagtcgatgataacatcccagagatgccgtcacccaaaaaaatg
caccaggggaagaaaaagaaacagaacaagaatcgcatctcttgggttggagaagccgtc
aagactgatgggaagaagagttactataagaaggtgtgcattgatgcagaaaccctggaa
gtgggggactgtgtttctgttattccagatgattcctcaaaaccgctgtatctagcaagg
gtcacggcgctgtgggaggacagcagcaacgggcagatgtttcacgcccactggttctgc
gctgggacagacacagtcctcggggccacttcggaccctctggagctgttcttggtggat
gaatgtgaggacatgcagctttcatatatccacagcaaagtgaaagtcatctacaaagcc
ccctccgaaaactgggccatggagggaggcatggatcccgagtccctgctggagggggac
gacgggaagacctacttctaccagctgtggtacgatcaagactatgcgagattcgagtcc
cctccaaaaacccagccaacagaggacaacaagttcaaattctgtgtgagctgtgcccgt
ctggctgagatgaggcaaaaagaaatccccagggtcctggagcagctcgaggacctggat
agccgggtcctctactactcagccaccaagaacggcatcctgtaccgagttggtgatggc
gtgtacctgccccctgaggccttcacgttcaacatcaagctgtccagtcctgtgaaacgc
ccacggaaggagcctgtggacgaggacctgtacccagagcactaccggaaatactccgac
tacatcaaaggcagcaacctggatgcccctgagccctaccgaattggccggatcaaagag
atcttctgtcccaagaagagcaacggcaggcccaacgagactgacatcaaaatccgggtc
aacaagttctacaggcctgagaacacccacaagtccactccagcgagctaccacgcagac
atcaacctgctgtactggagcgacgaggaggccgtggtggacttcaaggctgtgcagggc
cgctgcaccgtggagtatggggaggacctgcccgagtgcgtccaggtgtactccatgggc
ggccccgaccgcttctacttcctcgaggcctataatgcaaagaccaaaagctttgaagat
cctcccaaccatgcccgtagccctggaaacaaagggaagggcaagggaaaagggaagggc
aagcccaagtcccaagcctgtgagccgagcgagccagagatagagatcaagctgcccaag
ctgcggaccctggacgtgttttctggctgcggagggttgtcggagggattccaccaagca
ggcatctctgacacgctgtgggccatcgagatgtgggaccctgcagcccaggcattccgg
ctgaacaaccccggctccacagtgttcacagaggactgcaacatcctgctgaagctggtc
atggctggggagaccaccaactcccgcggccagcggctaccccagaagggagacgtggag
atgctgtgcggcgggccgccctgccagggcttcagcggcatgaaccgcttcaattcgcgc
acctactccaagttcaaaaactctctggtggtttccttcctcagctactgcgactactac
cggccccggttcttcctcctggagaatgtcaggaactttgtctccttcaagcgctccatg
gtcctgaagctcaccctccgctgcctggtccgcatgggctatcagtgcaccttcggcgtg
ctgcaggccggtcagtacggtgtggcccagacacggaggcgggccatcatcctggccgcg
gcccctggagagaagctccctctgttcccggagccactgcacgtgtttgctccccgggcc
tgccagctgagtgtggtggtggatgacaagaagtttgtgagcaacataaccaggttgagc
tcgggtcctttccggaccatcacggtgcgagacacgatgtccgacctgccggaggtgcgg
aatggagcctcggcactggagatctcctacaacggggagcctcagtcctggttccagagg
cagctccggggcgcacagtaccagcccatcctcagggaccacatctgtaaggacatgagt
gcattggtggctgcccgcatgcggcacatccccttggccccaggctcagactggcgcgat
ctgcccaacatcgaggtgcggctctcggacggcaccatggccaggaagctgcggtatacc
caccatgacaggaagaatggccgcagcagctctggggccctccgtggggtctgctcctgc
gtggaagccggcaaagcctgcgaccccgcagccaggcagttcaacaccctcatcccctgg
tgcctgccccacactgggaaccggcacaaccactgggctggcctctatggaaggctcgag
tgggatggcttcttcagcacaacggtcaccaaccccgagcccatgggcaagcagggccgt
gtgctccacccagagcagcaccgcgtggtgagcgtgcgggagtgtgcccgctcccagggc
ttccctgatacctaccggctcttcggcaacatcctggacaagcaccggcaggtgggcaat
gccgtgccaccgcccctggccaaagccattggcttggagatcaagctctgtatgttggcc
aaagcccgagagagtgcctcagctaaaataaaggaggaggaagctgctaaggactag

DBGET integrated database retrieval system