Pongo abelii (Sumatran orangutan): 100437034 Help Entry 100437034         CDS       T01416                                  Name (RefSeq) interferon alpha-4-like   KO K05414   interferon alpha Organism pon  Pongo abelii (Sumatran orangutan) Pathway pon04060   Cytokine-cytokine receptor interaction pon04151   PI3K-Akt signaling pathway pon04217   Necroptosis pon04620   Toll-like receptor signaling pathway pon04621   NOD-like receptor signaling pathway pon04622   RIG-I-like receptor signaling pathway pon04623   Cytosolic DNA-sensing pathway pon04630   JAK-STAT signaling pathway pon04650   Natural killer cell mediated cytotoxicity pon04936   Alcoholic liver disease pon05152   Tuberculosis pon05160   Hepatitis C pon05161   Hepatitis B pon05162   Measles pon05163   Human cytomegalovirus infection pon05164   Influenza A pon05165   Human papillomavirus infection pon05167   Kaposi sarcoma-associated herpesvirus infection pon05168   Herpes simplex virus 1 infection pon05169   Epstein-Barr virus infection pon05170   Human immunodeficiency virus 1 infection pon05171   Coronavirus disease - COVID-19 pon05200   Pathways in cancer pon05320   Autoimmune thyroid disease pon05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pon00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100437034    04151 PI3K-Akt signaling pathway     100437034   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100437034  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100437034  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100437034    04621 NOD-like receptor signaling pathway     100437034    04622 RIG-I-like receptor signaling pathway     100437034    04623 Cytosolic DNA-sensing pathway     100437034    04650 Natural killer cell mediated cytotoxicity     100437034  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100437034   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100437034    05161 Hepatitis B     100437034    05160 Hepatitis C     100437034    05171 Coronavirus disease - COVID-19     100437034    05164 Influenza A     100437034    05162 Measles     100437034    05168 Herpes simplex virus 1 infection     100437034    05163 Human cytomegalovirus infection     100437034    05167 Kaposi sarcoma-associated herpesvirus infection     100437034    05169 Epstein-Barr virus infection     100437034    05165 Human papillomavirus infection     100437034   09171 Infectious disease: bacterial    05152 Tuberculosis     100437034   09163 Immune disease    05320 Autoimmune thyroid disease     100437034   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100437034   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100437034  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pon04052]     100437034 Cytokines and neuropeptides [BR:pon04052]  Cytokines   Interferons    100437034 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Interferon CoV_NSP2_N iSTAND Motif Other DBs NCBI-GeneID:  100437034 NCBI-ProteinID:  XP_002819797 LinkDB All DBs Position 9:19434813..19435382 Genome browser AA seq 189 aa AA seqDB search MALSFPLLMAMLVLSCKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFG FPQEEFDGNQLQKAQAISVLHEMIQQTFNLFNTKDSSAAWEQSLLEKFSTELYQQLNDLE ACVIQEVGVEETPLMNEDSILAVKKYFQRITVYLTEKKYSPCAWEVVRAEVMRSFSYSTS LQKRIRRKD NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atggccctgtcctttcctttactgatggccatgctggtgctcagctgcaaatccatctgt tctctgggctgtgatctgcctcagactcacagcctgggtaataggagggccttgatactc ctggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgatttcgga ttcccccaggaggagtttgatggcaaccagttgcagaaggctcaagccatctctgtcctc catgagatgatccagcagaccttcaatctcttcaacacaaaggactcatctgctgcttgg gaacagagcctcctagaaaaattttccactgaactttaccagcaactgaatgacctggaa gcctgtgtgatacaggaggttggggtggaagagactcccctgatgaatgaggactccatc ctggctgtgaagaaatacttccaaagaatcactgtttatctcacagagaagaaatacagc ccttgtgcctgggaggttgtcagagcagaagtcatgagatccttctcttattcaacaagc ctgcaaaaaagaataaggaggaaggattga

DBGET integrated database retrieval system