KEGG   Pongo abelii (Sumatran orangutan): 100437111
Entry
100437111         CDS       T01416                                 

Definition
(RefSeq) interleukin-8 isoform X1
  KO
K10030  interleukin 8
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04061  Viral protein interaction with cytokine and cytokine receptor
pon04062  Chemokine signaling pathway
pon04064  NF-kappa B signaling pathway
pon04072  Phospholipase D signaling pathway
pon04218  Cellular senescence
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04657  IL-17 signaling pathway
pon04932  Non-alcoholic fatty liver disease
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05132  Salmonella infection
pon05133  Pertussis
pon05134  Legionellosis
pon05135  Yersinia infection
pon05142  Chagas disease
pon05144  Malaria
pon05146  Amoebiasis
pon05161  Hepatitis B
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05219  Bladder cancer
pon05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100437111
   04072 Phospholipase D signaling pathway
    100437111
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100437111
   04061 Viral protein interaction with cytokine and cytokine receptor
    100437111
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100437111
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100437111
   04621 NOD-like receptor signaling pathway
    100437111
   04622 RIG-I-like receptor signaling pathway
    100437111
   04657 IL-17 signaling pathway
    100437111
   04062 Chemokine signaling pathway
    100437111
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100437111
   05202 Transcriptional misregulation in cancer
    100437111
  09162 Cancer: specific types
   05219 Bladder cancer
    100437111
  09163 Immune disease
   05323 Rheumatoid arthritis
    100437111
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100437111
   04933 AGE-RAGE signaling pathway in diabetic complications
    100437111
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100437111
   05135 Yersinia infection
    100437111
   05133 Pertussis
    100437111
   05134 Legionellosis
    100437111
  09172 Infectious disease: viral
   05161 Hepatitis B
    100437111
   05171 Coronavirus disease - COVID-19
    100437111
   05164 Influenza A
    100437111
   05163 Human cytomegalovirus infection
    100437111
   05167 Kaposi sarcoma-associated herpesvirus infection
    100437111
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100437111
   05144 Malaria
    100437111
   05142 Chagas disease
    100437111
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100437111
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100437111
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Chemokines
   100437111
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Chemokines
   100437111
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100437111
NCBI-ProteinID: XP_009238349
LinkDB
Position
4
AA seq 101 aa
MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKMYSKPFHPKFIKELRVIESGPH
CANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENQNS
NT seq 306 nt   +upstreamnt  +downstreamnt
atgacttccaagctggccgtggctctcttggcagccttcctgatttctgcagctctgtgt
gaaggtgcagttttgccaaggagtgctaaagaacttagatgtcagtgcataaagatgtac
tccaaacctttccatcccaaatttatcaaagaactgagagtgattgagagtggaccacac
tgcgccaatacagaaattattgtaaagctttccgatggaagagagctctgtctggacccc
aaggaaaactgggtgcagagggttgtggagaagtttttgaagagggccgagaatcaaaat
tcataa

KEGG   Pongo abelii (Sumatran orangutan): 100437488
Entry
100437488         CDS       T01416                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: interleukin-8
  KO
K10030  interleukin 8
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04061  Viral protein interaction with cytokine and cytokine receptor
pon04062  Chemokine signaling pathway
pon04064  NF-kappa B signaling pathway
pon04072  Phospholipase D signaling pathway
pon04218  Cellular senescence
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04657  IL-17 signaling pathway
pon04932  Non-alcoholic fatty liver disease
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05132  Salmonella infection
pon05133  Pertussis
pon05134  Legionellosis
pon05135  Yersinia infection
pon05142  Chagas disease
pon05144  Malaria
pon05146  Amoebiasis
pon05161  Hepatitis B
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05219  Bladder cancer
pon05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100437488
   04072 Phospholipase D signaling pathway
    100437488
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100437488
   04061 Viral protein interaction with cytokine and cytokine receptor
    100437488
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100437488
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100437488
   04621 NOD-like receptor signaling pathway
    100437488
   04622 RIG-I-like receptor signaling pathway
    100437488
   04657 IL-17 signaling pathway
    100437488
   04062 Chemokine signaling pathway
    100437488
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100437488
   05202 Transcriptional misregulation in cancer
    100437488
  09162 Cancer: specific types
   05219 Bladder cancer
    100437488
  09163 Immune disease
   05323 Rheumatoid arthritis
    100437488
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100437488
   04933 AGE-RAGE signaling pathway in diabetic complications
    100437488
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100437488
   05135 Yersinia infection
    100437488
   05133 Pertussis
    100437488
   05134 Legionellosis
    100437488
  09172 Infectious disease: viral
   05161 Hepatitis B
    100437488
   05171 Coronavirus disease - COVID-19
    100437488
   05164 Influenza A
    100437488
   05163 Human cytomegalovirus infection
    100437488
   05167 Kaposi sarcoma-associated herpesvirus infection
    100437488
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100437488
   05144 Malaria
    100437488
   05142 Chagas disease
    100437488
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100437488
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100437488
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Chemokines
   100437488
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Chemokines
   100437488
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 100437488
NCBI-ProteinID: XP_002814903
Ensembl: ENSPPYG00000014826
UniProt: A0A663D645 H2PDK5
LinkDB
Position
4
AA seq 101 aa
MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPH
CANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENQNS
NT seq 306 nt   +upstreamnt  +downstreamnt
atgacttccaagctggccgtggctctcttggcagccttcctgatttctgcagctctgtgt
gaaggtgcagttttgccaaggagtgctaaagaacttagatgtcagtgcataaagacgtac
tccaaacctttccatcccaaatttatcaaagaactgagagtgattgagagtggaccacac
tgcgccaatacagaaattattgtaaagctttccgatggaagagagctctgtctggacccc
aaggaaaactgggtgcagagggttgtggagaaatttttgaagagggctgagaatcaaaat
tcataa

KEGG   Pongo abelii (Sumatran orangutan): 112128505
Entry
112128505         CDS       T01416                                 

Definition
(RefSeq) interleukin-8
  KO
K10030  interleukin 8
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04061  Viral protein interaction with cytokine and cytokine receptor
pon04062  Chemokine signaling pathway
pon04064  NF-kappa B signaling pathway
pon04072  Phospholipase D signaling pathway
pon04218  Cellular senescence
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04657  IL-17 signaling pathway
pon04932  Non-alcoholic fatty liver disease
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05132  Salmonella infection
pon05133  Pertussis
pon05134  Legionellosis
pon05135  Yersinia infection
pon05142  Chagas disease
pon05144  Malaria
pon05146  Amoebiasis
pon05161  Hepatitis B
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05219  Bladder cancer
pon05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    112128505
   04072 Phospholipase D signaling pathway
    112128505
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112128505
   04061 Viral protein interaction with cytokine and cytokine receptor
    112128505
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    112128505
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112128505
   04621 NOD-like receptor signaling pathway
    112128505
   04622 RIG-I-like receptor signaling pathway
    112128505
   04657 IL-17 signaling pathway
    112128505
   04062 Chemokine signaling pathway
    112128505
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112128505
   05202 Transcriptional misregulation in cancer
    112128505
  09162 Cancer: specific types
   05219 Bladder cancer
    112128505
  09163 Immune disease
   05323 Rheumatoid arthritis
    112128505
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112128505
   04933 AGE-RAGE signaling pathway in diabetic complications
    112128505
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112128505
   05135 Yersinia infection
    112128505
   05133 Pertussis
    112128505
   05134 Legionellosis
    112128505
  09172 Infectious disease: viral
   05161 Hepatitis B
    112128505
   05171 Coronavirus disease - COVID-19
    112128505
   05164 Influenza A
    112128505
   05163 Human cytomegalovirus infection
    112128505
   05167 Kaposi sarcoma-associated herpesvirus infection
    112128505
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112128505
   05144 Malaria
    112128505
   05142 Chagas disease
    112128505
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    112128505
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    112128505
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Chemokines
   112128505
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Chemokines
   112128505
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 112128505
NCBI-ProteinID: XP_009238350
LinkDB
Position
4
AA seq 95 aa
MTSKLAVALLAAFLISAALCEGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPH
CANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKR
NT seq 288 nt   +upstreamnt  +downstreamnt
atgacttccaagctggccgtggctctcttggcagccttcctgatttctgcagctctgtgt
gaaggtgcagttttgccaaggagtgctaaagaacttagatgtcagtgcataaagacgtac
tccaaacctttccatcccaaatttatcaaagaactgagagtgattgagagtggaccacac
tgcgccaatacagaaattattgtaaagctttccgatggaagagagctctgtctggacccc
aaggaaaactgggtgcagagggttgtggagaaatttttgaagaggtaa

DBGET integrated database retrieval system