KEGG   Pongo abelii (Sumatran orangutan): 100437175Help
Entry
100437175         CDS       T01416                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin G/H synthase 1 isoform X1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00590  Arachidonic acid metabolism
pon01100  Metabolic pathways
pon04611  Platelet activation
pon04726  Serotonergic synapse
pon04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    100437175 (PTGS1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100437175 (PTGS1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100437175 (PTGS1)
  09156 Nervous system
   04726 Serotonergic synapse
    100437175 (PTGS1)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100437175 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 100437175
NCBI-ProteinID: XP_024108236
LinkDB All DBs
Position
9
AA seq 617 aa AA seqDB search
MSRSLLLRFLLFLLLLPPLSVLLADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTR
TGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRS
NLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGVLDIFSCQRNPVSH
LNPRKKQLPDAQLLARRFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTAGKMGPGFTKA
LGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQS
QMAVGQEVFGLLPGLMLYATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIRI
VIEEYVQQLSGYFLQLKFDPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYS
YEQFLFNTSMLVDYGVEALVDAFSRQSAGRIGGGRNMDHHVLHVAVDVIRESREMRLQPF
NEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMI
EIGAPFSLKGLLGNPICSPEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVP
DASQDDGPAVERPSTEL
NT seq 1854 nt NT seq  +upstreamnt  +downstreamnt
atgagccggagtctcttgctccggttcttgctgttcctgctcctgctcccgccgctctcc
gtcctgctcgcggacccaggggcgcccacgccagtgaatccctgttgttactatccatgc
cagcaccagggcatctgtgtccgcttcggccttgaccgctaccagtgtgattgcacccgc
acgggctattccggccccaactgcaccatccctggcctgtggacctggctccggaattca
ctgcggcccagcccctctttcacccacttcctgctcactcacgggcgctggttctgggaa
tttgtcaatgccaccttcatccgagagatgctcatgcgcctggtactcacagtgcgctcc
aaccttatccccagtccccccacctacaactcagcacatgactacatcagctgggagtct
ttctccaacgtgagctattacactcgtattctgccctctgtgcctaaagactgccccaca
cccatgggaaccaaaggtgtacttgatattttttcctgccagaggaacccagtcagccat
cttaatccaaggaagaagcagttgccagatgcccagctcctggcccgccgcttcctgctc
aggaggaaattcatacctgacccccaaggcaccaacctcatgtttgccttctttgcacaa
cacttcacccaccagttcttcaaaactgctggcaagatgggtcctggtttcaccaaggcc
ttgggccatggagtagacctcggccacatttatggagacaatctggagcgtcagtatcaa
ctgcggctctttaaggatgggaaactcaagtaccaggtgctggacggagaaatgtacccg
ccctcggtagaagaggcgcctgtgttgatgcactacccccgaggcatcccgccccagagc
cagatggctgtgggccaggaggtgtttgggctgcttcccgggctcatgctgtatgccacg
ctctggctacgcgagcacaatcgtgtgtgtgacctgctgaaggctgagcaccccacctgg
ggcgatgagcagcttttccagacgacccgcctcatcctcataggggagaccatcaggatt
gtcattgaggagtacgtgcagcagctgagcggctacttcctgcagctaaaatttgaccca
gagctgctgttcggtgtccagttccaataccgcaaccgcattgccatggagttcaaccat
ctctaccactggcaccccctcatgcctgactccttcaaggtgggctcccaggagtacagc
tacgagcagttcttgttcaacacctccatgttggtggactatggggtcgaggccctggtg
gacgccttctctcgccagagtgctggccggatcggtgggggcaggaacatggaccaccac
gtcctgcacgtggctgtggatgtcatcagggagtctcgggagatgcggctgcagcccttc
aatgagtaccgcaagaggtttggcatgaagccctacacctccttccaagagctcgtagga
gagaaggagatggcagcagagttagaggaattgtatggagacattgatgcgttggagttc
tacccaggactgcttcttgaaaagtgccatccaaactctatctttggggagagtatgata
gagattggggctcccttttccctcaagggtctcctagggaatcccatctgttctccggag
tactggaagccgagcacatttggcggcgaggtgggctttaacatcgtcaagacggccaca
ctgaagaagctggtctgcctcaacaccaagacctgtccctacgtttccttccgtgtgccg
gatgccagtcaggatgatgggcctgctgtggagcgaccatccacagagctctga

DBGET integrated database retrieval system