KEGG   Pongo abelii (Sumatran orangutan): 100437263
Entry
100437263         CDS       T01416                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04010  MAPK signaling pathway
pon04015  Rap1 signaling pathway
pon04068  FoxO signaling pathway
pon04071  Sphingolipid signaling pathway
pon04114  Oocyte meiosis
pon04218  Cellular senescence
pon04261  Adrenergic signaling in cardiomyocytes
pon04370  VEGF signaling pathway
pon04380  Osteoclast differentiation
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04611  Platelet activation
pon04613  Neutrophil extracellular trap formation
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04625  C-type lectin receptor signaling pathway
pon04657  IL-17 signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon04660  T cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04668  TNF signaling pathway
pon04670  Leukocyte transendothelial migration
pon04714  Thermogenesis
pon04722  Neurotrophin signaling pathway
pon04723  Retrograde endocannabinoid signaling
pon04728  Dopaminergic synapse
pon04750  Inflammatory mediator regulation of TRP channels
pon04912  GnRH signaling pathway
pon04914  Progesterone-mediated oocyte maturation
pon04917  Prolactin signaling pathway
pon04926  Relaxin signaling pathway
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04935  Growth hormone synthesis, secretion and action
pon05014  Amyotrophic lateral sclerosis
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
pon05133  Pertussis
pon05135  Yersinia infection
pon05140  Leishmaniasis
pon05142  Chagas disease
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05161  Hepatitis B
pon05163  Human cytomegalovirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05205  Proteoglycans in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100437263 (MAPK12)
   04015 Rap1 signaling pathway
    100437263 (MAPK12)
   04370 VEGF signaling pathway
    100437263 (MAPK12)
   04668 TNF signaling pathway
    100437263 (MAPK12)
   04068 FoxO signaling pathway
    100437263 (MAPK12)
   04071 Sphingolipid signaling pathway
    100437263 (MAPK12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100437263 (MAPK12)
   04218 Cellular senescence
    100437263 (MAPK12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100437263 (MAPK12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100437263 (MAPK12)
   04613 Neutrophil extracellular trap formation
    100437263 (MAPK12)
   04620 Toll-like receptor signaling pathway
    100437263 (MAPK12)
   04621 NOD-like receptor signaling pathway
    100437263 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    100437263 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    100437263 (MAPK12)
   04660 T cell receptor signaling pathway
    100437263 (MAPK12)
   04658 Th1 and Th2 cell differentiation
    100437263 (MAPK12)
   04659 Th17 cell differentiation
    100437263 (MAPK12)
   04657 IL-17 signaling pathway
    100437263 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    100437263 (MAPK12)
   04670 Leukocyte transendothelial migration
    100437263 (MAPK12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100437263 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    100437263 (MAPK12)
   04917 Prolactin signaling pathway
    100437263 (MAPK12)
   04926 Relaxin signaling pathway
    100437263 (MAPK12)
   04935 Growth hormone synthesis, secretion and action
    100437263 (MAPK12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100437263 (MAPK12)
  09156 Nervous system
   04728 Dopaminergic synapse
    100437263 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    100437263 (MAPK12)
   04722 Neurotrophin signaling pathway
    100437263 (MAPK12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100437263 (MAPK12)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100437263 (MAPK12)
  09159 Environmental adaptation
   04714 Thermogenesis
    100437263 (MAPK12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100437263 (MAPK12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100437263 (MAPK12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100437263 (MAPK12)
   05020 Prion disease
    100437263 (MAPK12)
   05022 Pathways of neurodegeneration - multiple diseases
    100437263 (MAPK12)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100437263 (MAPK12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100437263 (MAPK12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100437263 (MAPK12)
   05135 Yersinia infection
    100437263 (MAPK12)
   05133 Pertussis
    100437263 (MAPK12)
   05152 Tuberculosis
    100437263 (MAPK12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100437263 (MAPK12)
   05161 Hepatitis B
    100437263 (MAPK12)
   05171 Coronavirus disease - COVID-19
    100437263 (MAPK12)
   05163 Human cytomegalovirus infection
    100437263 (MAPK12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100437263 (MAPK12)
   05169 Epstein-Barr virus infection
    100437263 (MAPK12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100437263 (MAPK12)
   05140 Leishmaniasis
    100437263 (MAPK12)
   05142 Chagas disease
    100437263 (MAPK12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100437263 (MAPK12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100437263 (MAPK12)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100437263 (MAPK12)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100437263 (MAPK12)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like
Other DBs
NCBI-GeneID: 100437263
NCBI-ProteinID: XP_024095916
Ensembl: ENSPPYG00000011980
LinkDB
Position
22
AA seq 367 aa
MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDSRTGAKVAIKKLYR
PFQSDLFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM
KHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMK
VTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRV
TAAEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVLSFKPPQQLGAR
VSKETAL
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgagctctccgccgcccgcccgcagtggcttttaccgccaggaggtgaccaagacggcc
tgggaggtgcgcgccgtgtaccgggacctgcagcccgtgggctcgggcgcctatggcgcg
gtgtgctcggccgtggacagccgcaccggcgctaaggtagccatcaagaagctgtatcgg
cccttccagtccgacctgttcgccaagcgcgcctaccgcgagctgcgcctgctcaagcac
atgcgccacgagaacgtgatcgggctgctggacgtattcactcctgatgagaccctggat
gacttcacggacttttacctggtgatgccgttcatgggcaccgacctgggcaagctcatg
aaacatgagaagctaggcgaggaccggatccagtttctcgtgtaccagatgctgaagggg
ctgaggtatatccacgctgctggcatcatccacagagacctgaagcccggcaacctggct
gtgaacgaagactgtgagctgaagatcctggacttcggcctggccaggcaggcagacagt
gagatgactgggtacgtggtgacccggtggtaccgggctcccgaggtcatcttgaattgg
atgcgctacacgcagacggtggacatctggtctgtgggctgcatcatggcagagatgatc
acaggcaagacgctgttcaagggcagcgaccacctggaccagctgaaggagatcatgaag
gtgacggggacgcctccggctgagtttgtgcagcggctgcagagcgatgaggccaagaac
tacatgaagggcctccccgaattggagaagaaggattttgcctccatcctcaccaatgca
agccctctggctgtgaacctcctggagaagatgctggtgctggatgcggagcagcgggtg
acagcggccgaggcgctggcccatccctactttgagtccctgcacgacacggaagatgag
ccccaggtccagaagtatgatgactcctttgacgacgtggaccgcacactggatgaatgg
aagcgtgttacttacaaagaggtgctcagcttcaagcctccccagcagctgggggccagg
gtctccaaggagacggctctgtga

KEGG   Pongo abelii (Sumatran orangutan): 100438358
Entry
100438358         CDS       T01416                                 

Gene name
MAPK11
Definition
(RefSeq) mitogen-activated protein kinase 11
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04010  MAPK signaling pathway
pon04015  Rap1 signaling pathway
pon04068  FoxO signaling pathway
pon04071  Sphingolipid signaling pathway
pon04114  Oocyte meiosis
pon04218  Cellular senescence
pon04261  Adrenergic signaling in cardiomyocytes
pon04370  VEGF signaling pathway
pon04380  Osteoclast differentiation
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04611  Platelet activation
pon04613  Neutrophil extracellular trap formation
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04625  C-type lectin receptor signaling pathway
pon04657  IL-17 signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon04660  T cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04668  TNF signaling pathway
pon04670  Leukocyte transendothelial migration
pon04714  Thermogenesis
pon04722  Neurotrophin signaling pathway
pon04723  Retrograde endocannabinoid signaling
pon04728  Dopaminergic synapse
pon04750  Inflammatory mediator regulation of TRP channels
pon04912  GnRH signaling pathway
pon04914  Progesterone-mediated oocyte maturation
pon04917  Prolactin signaling pathway
pon04926  Relaxin signaling pathway
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04935  Growth hormone synthesis, secretion and action
pon05014  Amyotrophic lateral sclerosis
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
pon05133  Pertussis
pon05135  Yersinia infection
pon05140  Leishmaniasis
pon05142  Chagas disease
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05161  Hepatitis B
pon05163  Human cytomegalovirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05205  Proteoglycans in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100438358 (MAPK11)
   04015 Rap1 signaling pathway
    100438358 (MAPK11)
   04370 VEGF signaling pathway
    100438358 (MAPK11)
   04668 TNF signaling pathway
    100438358 (MAPK11)
   04068 FoxO signaling pathway
    100438358 (MAPK11)
   04071 Sphingolipid signaling pathway
    100438358 (MAPK11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100438358 (MAPK11)
   04218 Cellular senescence
    100438358 (MAPK11)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100438358 (MAPK11)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100438358 (MAPK11)
   04613 Neutrophil extracellular trap formation
    100438358 (MAPK11)
   04620 Toll-like receptor signaling pathway
    100438358 (MAPK11)
   04621 NOD-like receptor signaling pathway
    100438358 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    100438358 (MAPK11)
   04625 C-type lectin receptor signaling pathway
    100438358 (MAPK11)
   04660 T cell receptor signaling pathway
    100438358 (MAPK11)
   04658 Th1 and Th2 cell differentiation
    100438358 (MAPK11)
   04659 Th17 cell differentiation
    100438358 (MAPK11)
   04657 IL-17 signaling pathway
    100438358 (MAPK11)
   04664 Fc epsilon RI signaling pathway
    100438358 (MAPK11)
   04670 Leukocyte transendothelial migration
    100438358 (MAPK11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100438358 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    100438358 (MAPK11)
   04917 Prolactin signaling pathway
    100438358 (MAPK11)
   04926 Relaxin signaling pathway
    100438358 (MAPK11)
   04935 Growth hormone synthesis, secretion and action
    100438358 (MAPK11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100438358 (MAPK11)
  09156 Nervous system
   04728 Dopaminergic synapse
    100438358 (MAPK11)
   04723 Retrograde endocannabinoid signaling
    100438358 (MAPK11)
   04722 Neurotrophin signaling pathway
    100438358 (MAPK11)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100438358 (MAPK11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100438358 (MAPK11)
  09159 Environmental adaptation
   04714 Thermogenesis
    100438358 (MAPK11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100438358 (MAPK11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100438358 (MAPK11)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100438358 (MAPK11)
   05020 Prion disease
    100438358 (MAPK11)
   05022 Pathways of neurodegeneration - multiple diseases
    100438358 (MAPK11)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100438358 (MAPK11)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100438358 (MAPK11)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100438358 (MAPK11)
   05135 Yersinia infection
    100438358 (MAPK11)
   05133 Pertussis
    100438358 (MAPK11)
   05152 Tuberculosis
    100438358 (MAPK11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100438358 (MAPK11)
   05161 Hepatitis B
    100438358 (MAPK11)
   05171 Coronavirus disease - COVID-19
    100438358 (MAPK11)
   05163 Human cytomegalovirus infection
    100438358 (MAPK11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100438358 (MAPK11)
   05169 Epstein-Barr virus infection
    100438358 (MAPK11)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100438358 (MAPK11)
   05140 Leishmaniasis
    100438358 (MAPK11)
   05142 Chagas disease
    100438358 (MAPK11)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100438358 (MAPK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100438358 (MAPK11)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100438358 (MAPK11)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100438358 (MAPK11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Cas_CT1975 Kinase-like
Other DBs
NCBI-GeneID: 100438358
NCBI-ProteinID: XP_024095644
LinkDB
Position
22
AA seq 364 aa
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGNL
EIEQ
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgtcgggccctcgcgccggcttctaccggcaagagctgaacaagaccgtgtgggaggtg
ccgcagcggctgcaggggctgcgcccggtgggctccggcgcctacggctccgtctgttcg
gcctacgacgcgcggctgcgccagaaggtggcggtgaagaagctgtcgcgccccttccag
tcgctgatccacgcgcgcagaacgtaccgagagctgcggctgctcaagcacctgaagcac
gagaacgtcatcgggcttctggacgtcttcacgccggccacgtccatcgaggacttcagc
gaagtgtacttggtgaccaccctgatgggcgccgacctgaacaacatcgtcaagtgccag
gcgctgagcgacgagcacgttcaattcctggtttaccagctgctgcgcgggctgaagtac
atccactcggccgggatcatccaccgggacctgaagcccagcaacgtggctgtgaacgag
gactgtgagctcaggatcctggacttcgggctggcgcgccaggcagatgaggagatgacc
ggctatgtggccacgcgctggtaccgggcacctgagatcatgctcaactggatgcattac
aaccagacagtggatatctggtccgtgggctgcatcatggctgaactgctccagggcaag
gccctcttcccgggaagcgactacattgaccagctgaagcgcatcatggaagtggtgggc
acacccagccctgaggttctggcaaagatctcctcagaacacgcccggacatatatccag
tccctgccccccatgccccagaaggacctgagcagcatcttccgtggagccaaccccctg
gccatagacctccttggaaggatgctggtgctggacagtgaccagagggtcagtgcggct
gaggcactggcccacgcctacttcagccagtaccatgaccctgaggatgagccagaggcc
gagccctatgatgagagcgttgaggccaaggagcgcacgctggaggagtggaaggagctc
acctaccaggaagtcctcagcttcaagcccccagagccaccgaagccacctggcaacctg
gagattgagcagtga

KEGG   Pongo abelii (Sumatran orangutan): 100449269
Entry
100449269         CDS       T01416                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14 isoform X2
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04010  MAPK signaling pathway
pon04015  Rap1 signaling pathway
pon04068  FoxO signaling pathway
pon04071  Sphingolipid signaling pathway
pon04114  Oocyte meiosis
pon04218  Cellular senescence
pon04261  Adrenergic signaling in cardiomyocytes
pon04370  VEGF signaling pathway
pon04380  Osteoclast differentiation
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04611  Platelet activation
pon04613  Neutrophil extracellular trap formation
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04625  C-type lectin receptor signaling pathway
pon04657  IL-17 signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon04660  T cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04668  TNF signaling pathway
pon04670  Leukocyte transendothelial migration
pon04714  Thermogenesis
pon04722  Neurotrophin signaling pathway
pon04723  Retrograde endocannabinoid signaling
pon04728  Dopaminergic synapse
pon04750  Inflammatory mediator regulation of TRP channels
pon04912  GnRH signaling pathway
pon04914  Progesterone-mediated oocyte maturation
pon04917  Prolactin signaling pathway
pon04926  Relaxin signaling pathway
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04935  Growth hormone synthesis, secretion and action
pon05014  Amyotrophic lateral sclerosis
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
pon05133  Pertussis
pon05135  Yersinia infection
pon05140  Leishmaniasis
pon05142  Chagas disease
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05161  Hepatitis B
pon05163  Human cytomegalovirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05205  Proteoglycans in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100449269 (MAPK14)
   04015 Rap1 signaling pathway
    100449269 (MAPK14)
   04370 VEGF signaling pathway
    100449269 (MAPK14)
   04668 TNF signaling pathway
    100449269 (MAPK14)
   04068 FoxO signaling pathway
    100449269 (MAPK14)
   04071 Sphingolipid signaling pathway
    100449269 (MAPK14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100449269 (MAPK14)
   04218 Cellular senescence
    100449269 (MAPK14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100449269 (MAPK14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100449269 (MAPK14)
   04613 Neutrophil extracellular trap formation
    100449269 (MAPK14)
   04620 Toll-like receptor signaling pathway
    100449269 (MAPK14)
   04621 NOD-like receptor signaling pathway
    100449269 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    100449269 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    100449269 (MAPK14)
   04660 T cell receptor signaling pathway
    100449269 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    100449269 (MAPK14)
   04659 Th17 cell differentiation
    100449269 (MAPK14)
   04657 IL-17 signaling pathway
    100449269 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    100449269 (MAPK14)
   04670 Leukocyte transendothelial migration
    100449269 (MAPK14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100449269 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    100449269 (MAPK14)
   04917 Prolactin signaling pathway
    100449269 (MAPK14)
   04926 Relaxin signaling pathway
    100449269 (MAPK14)
   04935 Growth hormone synthesis, secretion and action
    100449269 (MAPK14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100449269 (MAPK14)
  09156 Nervous system
   04728 Dopaminergic synapse
    100449269 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    100449269 (MAPK14)
   04722 Neurotrophin signaling pathway
    100449269 (MAPK14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100449269 (MAPK14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100449269 (MAPK14)
  09159 Environmental adaptation
   04714 Thermogenesis
    100449269 (MAPK14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100449269 (MAPK14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100449269 (MAPK14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100449269 (MAPK14)
   05020 Prion disease
    100449269 (MAPK14)
   05022 Pathways of neurodegeneration - multiple diseases
    100449269 (MAPK14)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100449269 (MAPK14)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100449269 (MAPK14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100449269 (MAPK14)
   05135 Yersinia infection
    100449269 (MAPK14)
   05133 Pertussis
    100449269 (MAPK14)
   05152 Tuberculosis
    100449269 (MAPK14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100449269 (MAPK14)
   05161 Hepatitis B
    100449269 (MAPK14)
   05171 Coronavirus disease - COVID-19
    100449269 (MAPK14)
   05163 Human cytomegalovirus infection
    100449269 (MAPK14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100449269 (MAPK14)
   05169 Epstein-Barr virus infection
    100449269 (MAPK14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100449269 (MAPK14)
   05140 Leishmaniasis
    100449269 (MAPK14)
   05142 Chagas disease
    100449269 (MAPK14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100449269 (MAPK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100449269 (MAPK14)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100449269 (MAPK14)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100449269 (MAPK14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH NAD_binding_8 Kinase-like
Other DBs
NCBI-GeneID: 100449269
NCBI-ProteinID: XP_002816847
Ensembl: ENSPPYG00000016539
UniProt: A0A2J8Y3G6
LinkDB
Position
6
AA seq 360 aa
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFSDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTG
TPPAYLINRMPSHEARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagacaatctgggaggtg
cccgagcgttaccagaacctgtctccagtgggctccggcgcctatggctctgtgtgtgct
gcttttgacacaaaaacggggttacgtgtggcagtgaagaagctctccagaccatttcag
tccatcattcatgccaaaagaacctacagagaactgcggttacttaaacatatgaaacat
gaaaatgtgattggtctgttggatgtttttacacctgcaaggtctctggaggaattcagt
gatgtgtatttggtgacccatctcatgggggcagatctgaacaacattgtgaaatgtcag
aagctcacagatgaccatgttcagttccttatctaccaaattctccgaggtctaaagtat
atacattcagctgacataattcacagggacctaaaacctagtaatctagctgtgaatgaa
gactgtgagctgaagattctggattttggactggctcggcacacagatgatgaaatgaca
ggctacgtggccactaggtggtacagggctcctgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga
acattgtttcctggtacagaccatattaaccagcttcagcagattatgcgtctgacagga
acaccccccgcttatctcattaacaggatgccaagccatgaggcaagaaactatattcag
tctttgactcagatgccgaagatgaactttgcgaatgtatttattggtgccaatcccctg
gctgtcgacttgctggagaagatgcttgtattggactcagataagagaattacggcggcc
caagcccttgcacatgcctactttgctcagtaccacgatcctgatgatgaaccagtggcc
gatccttatgatcagtcctttgaaagcagggacctccttatagatgagtggaaaagcctg
acctatgatgaagtcatcagctttgtgccaccaccccttgaccaagaagagatggagtcc
tga

KEGG   Pongo abelii (Sumatran orangutan): 100449853
Entry
100449853         CDS       T01416                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04010  MAPK signaling pathway
pon04015  Rap1 signaling pathway
pon04068  FoxO signaling pathway
pon04071  Sphingolipid signaling pathway
pon04114  Oocyte meiosis
pon04218  Cellular senescence
pon04261  Adrenergic signaling in cardiomyocytes
pon04370  VEGF signaling pathway
pon04380  Osteoclast differentiation
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04611  Platelet activation
pon04613  Neutrophil extracellular trap formation
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04625  C-type lectin receptor signaling pathway
pon04657  IL-17 signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon04660  T cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04668  TNF signaling pathway
pon04670  Leukocyte transendothelial migration
pon04714  Thermogenesis
pon04722  Neurotrophin signaling pathway
pon04723  Retrograde endocannabinoid signaling
pon04728  Dopaminergic synapse
pon04750  Inflammatory mediator regulation of TRP channels
pon04912  GnRH signaling pathway
pon04914  Progesterone-mediated oocyte maturation
pon04917  Prolactin signaling pathway
pon04926  Relaxin signaling pathway
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04935  Growth hormone synthesis, secretion and action
pon05014  Amyotrophic lateral sclerosis
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
pon05133  Pertussis
pon05135  Yersinia infection
pon05140  Leishmaniasis
pon05142  Chagas disease
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05161  Hepatitis B
pon05163  Human cytomegalovirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05205  Proteoglycans in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100449853 (MAPK13)
   04015 Rap1 signaling pathway
    100449853 (MAPK13)
   04370 VEGF signaling pathway
    100449853 (MAPK13)
   04668 TNF signaling pathway
    100449853 (MAPK13)
   04068 FoxO signaling pathway
    100449853 (MAPK13)
   04071 Sphingolipid signaling pathway
    100449853 (MAPK13)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    100449853 (MAPK13)
   04218 Cellular senescence
    100449853 (MAPK13)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100449853 (MAPK13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100449853 (MAPK13)
   04613 Neutrophil extracellular trap formation
    100449853 (MAPK13)
   04620 Toll-like receptor signaling pathway
    100449853 (MAPK13)
   04621 NOD-like receptor signaling pathway
    100449853 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    100449853 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    100449853 (MAPK13)
   04660 T cell receptor signaling pathway
    100449853 (MAPK13)
   04658 Th1 and Th2 cell differentiation
    100449853 (MAPK13)
   04659 Th17 cell differentiation
    100449853 (MAPK13)
   04657 IL-17 signaling pathway
    100449853 (MAPK13)
   04664 Fc epsilon RI signaling pathway
    100449853 (MAPK13)
   04670 Leukocyte transendothelial migration
    100449853 (MAPK13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100449853 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    100449853 (MAPK13)
   04917 Prolactin signaling pathway
    100449853 (MAPK13)
   04926 Relaxin signaling pathway
    100449853 (MAPK13)
   04935 Growth hormone synthesis, secretion and action
    100449853 (MAPK13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100449853 (MAPK13)
  09156 Nervous system
   04728 Dopaminergic synapse
    100449853 (MAPK13)
   04723 Retrograde endocannabinoid signaling
    100449853 (MAPK13)
   04722 Neurotrophin signaling pathway
    100449853 (MAPK13)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100449853 (MAPK13)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100449853 (MAPK13)
  09159 Environmental adaptation
   04714 Thermogenesis
    100449853 (MAPK13)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100449853 (MAPK13)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100449853 (MAPK13)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    100449853 (MAPK13)
   05020 Prion disease
    100449853 (MAPK13)
   05022 Pathways of neurodegeneration - multiple diseases
    100449853 (MAPK13)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100449853 (MAPK13)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100449853 (MAPK13)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100449853 (MAPK13)
   05135 Yersinia infection
    100449853 (MAPK13)
   05133 Pertussis
    100449853 (MAPK13)
   05152 Tuberculosis
    100449853 (MAPK13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100449853 (MAPK13)
   05161 Hepatitis B
    100449853 (MAPK13)
   05171 Coronavirus disease - COVID-19
    100449853 (MAPK13)
   05163 Human cytomegalovirus infection
    100449853 (MAPK13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100449853 (MAPK13)
   05169 Epstein-Barr virus infection
    100449853 (MAPK13)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100449853 (MAPK13)
   05140 Leishmaniasis
    100449853 (MAPK13)
   05142 Chagas disease
    100449853 (MAPK13)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100449853 (MAPK13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100449853 (MAPK13)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100449853 (MAPK13)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100449853 (MAPK13)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kinase-like Kdo DUF4023 FTA2
Other DBs
NCBI-GeneID: 100449853
NCBI-ProteinID: XP_002816849
Ensembl: ENSPPYG00000016540
UniProt: A0A6D2YBF6 H2PIU8
LinkDB
Position
6
AA seq 365 aa
MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGAVCSAIDKRSGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFHDFYLVMPFMQTDLQKIMGM
EFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAA
QALTHPFFEPFRDPEEETEAQQPLDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRR
SGMKL
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgagcctcatccggaaaaagggcttctacaagcaggacgtcaacaagaccgcctgggag
ctgcccaagacctacgtgtccccgacgcacgtcggcagcggggcctatggcgccgtgtgc
tcggccatcgacaagcggtcaggggagaaggtggccatcaagaagttgagccgacccttt
cagtccgagatcttcgccaagcgcgcctaccgggagctgctgctgctgaagcacatgcag
catgagaacgtcattgggctcctggatgtcttcaccccagcctcctccctgcgcaacttc
catgacttctacctggtgatgcccttcatgcagacggatctgcagaagatcatggggatg
gagttcagtgaggagaaaatccagtacctggtgtatcagatgctcaaaggccttaagtac
atccactcggctggggtcgtgcacagggacctgaagccaggcaacctggctgtgaatgag
gactgtgaactgaagattctggattttgggctggcgcgacatgcagatgccgaaatgact
ggctacgtggtgacccgctggtaccgagcccccgaggtgatcctcagctggatgcactac
aaccagacggtggacatctggtctgtgggctgtatcatggcagagatgctgacagggaaa
actctgttcaaggggaaagattacctggaccagctgacccagatcctgaaagtgaccggg
gtgcctggcacggagtttgtgcagaagctgaacgacaaagcggccaaatcgtacatccag
tccctgccacagacccccaggaaggatttcactcagctcttcccacgggccagcccccag
gccgcagacctgctggagaagatgctggagctagacgtggacaagcgcttgacggccgca
caggccctcacccatcccttctttgaacccttccgggaccctgaggaagagacggaggcc
cagcagccgttagatgattccttagaacacgagaaactcacagtggatgaatggaagcag
cacatctacaaggagattgtgaacttcagccccattgcccggaaggactcgcggcgccgg
agtggcatgaagctgtag

DBGET integrated database retrieval system