KEGG   Pongo abelii (Sumatran orangutan): 100437504
Entry
100437504         CDS       T01416                                 

Gene name
DIAPH1
Definition
(RefSeq) LOW QUALITY PROTEIN: protein diaphanous homolog 1
  KO
K05740  diaphanous 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04510  Focal adhesion
pon04810  Regulation of actin cytoskeleton
pon04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100437504 (DIAPH1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100437504 (DIAPH1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100437504 (DIAPH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100437504 (DIAPH1)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Formins
     100437504 (DIAPH1)
SSDB
Motif
Pfam: FH2 Drf_FH3 Drf_GBD Drf_FH1 Drf_DAD DUF3450 Glucan_synthase DUF948
Other DBs
NCBI-GeneID: 100437504
NCBI-ProteinID: XP_024102636
LinkDB
Position
5
AA seq 1276 aa
MEPPGGSLGPGRGTRDKKKGRSPDELPSAGGDGGKSKKFTLKRLMADELERFTSMRIKKE
KEKPNSAHRNSSASYGDDPTAQSLQDVSDEQVLVLFEQMLLDMNLNEEKQQPLREKDIII
KREMVSQYLYTSKAGMSQKESSKSAMMYIQELRSGLRDMPLLSCLESLRVSLNNNPVSWV
QTFGAEGLASLLDILKRLHDEKEETAGSYDSRNKHEIIRCLKAFMNNKFGIKTMLETEEG
ILLLVRAMDPAVPNMMIDAAKLLSALCILPQPEDMNERVLEAMTERAEMDEVERFQPLLD
GLKSGTTIALKVGCLQLINALITPAEELDFRVHIRSELMRLGLHQVLQDLREIENEDMRV
QLNVFDEQGEEDSYDLKGRLDDIRMEMDDFNEVFQILLNTVKDSKAEPHFLSILQHLLLV
RNDYEARPQYYKLIEECISQIVLHKNGADPDFKCRHLQIEIEGLIDQMIDKTKVEKSEAK
AAELEKKLDSELTARHELQVEMKKMESDFEQKLQDLHGEKDALHSEKQQIATEKQDLEAE
VSQLTGEVAKLTKELEDAKKEMASLSVAAITVAPSVPSSATVPPAPPLPGDSGTIIPPPS
APGDSTTSPPPPPPPPPPPPPPPPLPGGVCISSPPSLPRGTATSLPPPLSGDASIPPPPP
LPGDVGIPALSSLSEGTAXPPPPPLPGSAGIPPAPPPLPGSAGXPPPPPPLPGGAGMPPP
PPPLPGGPGIPPPPPFPGGPGIPPPPPGMGMPPPPPFGFGVPAAPVLPFGLTPKKLYKPE
VQLRRPNWSKLVAEDLSQDCFWTKVKEDRFENNELFAKLTLTFSAQTKTSKAKKDQEGGE
EKKSVQKKKVKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIK
QMPEPEQLKMLSELKDEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPE
IVSVTAACEELRKSESFSNLLEITLLVGNYMNAGSRNAGAFGFNISFLCKLRDTKSTDQK
MTLLHFLAELCENDYPDVLKFPDELAHVEKASRVSAENLQKNLDQMKKQISDVERDVQNF
PAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGEYFLFDPKKLSVEEFFM
DLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERLEKQQKREQLIDMNAEGDET
GVMDSLLEALQSGAAFRRKRGPRQANRKAGCAVTSLLASELTKDDAMAAVPAKVSKNSET
FPTILEEAKELVGRAS
NT seq 3831 nt   +upstreamnt  +downstreamnt
atggagccgcccggcgggagcctggggcccggccgcgggactcgggacaagaagaagggc
cggagcccagatgagctgccctcggcgggcggcgacggcggcaaatctaagaaatttact
ctgaagcggctcatggcagatgagctggagagatttaccagcatgagaattaagaaggag
aaggaaaagcccaattctgctcatagaaattcttctgcatcatatggggatgatcccaca
gcacagtcattgcaagatgtttcagatgaacaagttctggttctctttgaacagatgctg
ctggatatgaacctgaatgaggagaagcagcaacctttgagggagaaggacatcatcatc
aagagggagatggtgtcccaatacttgtacacctccaaggctggcatgagccagaaggag
agctctaagtctgccatgatgtatattcaggagttgaggtcaggcttgcgggatatgcct
ctgctcagctgcctggagtcccttcgtgtgtctctcaacaacaaccctgtcagttgggtg
caaacatttggtgctgaaggcttggcctccttattggacattcttaaacgacttcatgat
gagaaagaagagactgccgggagttacgatagccggaacaagcatgagatcattcgctgc
ttgaaagcttttatgaacaacaagtttggaatcaagaccatgttggagacagaagaagga
atcctactgctggtcagagccatggatcctgctgttcccaacatgatgattgatgcagct
aagctgctttctgctctttgtattctaccacagccagaggacatgaatgaaagggttttg
gaggcaatgacagaaagagctgagatggatgaagtggaacgtttccagccactgctggat
ggattaaaaagtggaaccactattgcactgaaggttggatgcctacagctgatcaatgct
ctcatcacaccagcggaggaacttgacttccgagttcacatcagaagtgaactgatgcgt
ttggggctacatcaggtgttgcaggaccttcgagagattgaaaatgaagatatgagagtg
caactaaatgtgtttgatgaacaaggggaagaagattcctatgacctgaagggacggctg
gatgacattcgcatggagatggatgactttaatgaagtctttcagattctcttaaacaca
gtgaaggattcaaaggcagagccacacttcctttccatcctgcagcacttactcttggtc
cgaaatgactatgaggccagacctcagtactataagttgattgaagaatgtatttcccag
atagttctgcacaagaacggggctgatcctgacttcaagtgccggcacctccagattgag
attgagggattaattgatcaaatgattgataagacaaaggtggagaaatctgaagccaaa
gctgcagagctggaaaagaagttggactcagagttaacagcccgacatgagctacaggtg
gaaatgaaaaagatggaaagtgactttgagcagaagcttcaagatcttcatggagaaaaa
gatgcactgcattctgaaaagcagcaaattgccacagagaaacaggacctggaagcagag
gtgtcccagctcacaggagaggttgccaagctgacaaaggaactggaagatgccaagaaa
gaaatggcgtccctctctgtggcagctattactgtagctccttctgttcctagtagtgct
actgttccccctgcccctcctttacctggtgactctggcactattattccaccaccatct
gcccctggggatagtaccacttctcctcctcctcctcctcctcctcctcctcctcctcct
ccaccacctcctttgcctgggggtgtttgcatctcctcacccccttctttacctagaggt
actgctacctctctaccccctcctttgtctggggatgctagcatccctccaccccctcct
ttgcctggggatgttggcatccctgcactctcttctttgtctgaaggtactgccnatccc
ccacctcctcctttgcctgggagtgctggaatcccccccgcaccacctcctttgcctggg
agtgctgganatccccccccacctcctcccttgcctggaggagcaggaatgccacctcct
cctccccctcttcctggtggtcctggaatccctccacctcctccatttcctggaggccct
ggcattcctccacctccacccggaatgggtatgcctccacctcccccatttggatttgga
gttcctgcagccccagttctgccatttggattaacccccaaaaagctttataagccagag
gtgcagctccggaggccaaactggtccaagcttgtggctgaggacctctcccaggactgc
ttctggacaaaggtgaaggaggaccgctttgagaacaatgaacttttcgccaaacttacc
cttaccttctctgctcagaccaagacttccaaagccaagaaggatcaagaaggtggagaa
gaaaagaaatctgtgcaaaagaaaaaagtaaaagagttaaaggtgttggattcaaagaca
gcccagaatctctcaatctttttgggttccttccgcatgccctatcaagagattaagaat
gtcatcctggaggtgaatgaggctgttctgactgaatctatgatccagaacctcattaag
caaatgccagagccagagcagttaaaaatgctttctgaactgaaggatgaatatgatgac
ctggctgagtcagagcagtttggcgtggtgatgggcactgtgccccgactgcggcctcgc
ctcaatgccattctcttcaagctacaattcagcgagcaagtggagaatatcaagccagag
attgtgtctgtcactgctgcatgtgaggagttacgtaagagtgagagcttttccaatctc
ctagagattaccttgcttgttggaaattacatgaatgctggctccagaaatgctggtgct
tttggcttcaatatcagcttcctctgtaagcttcgagacaccaagtccacagatcagaag
atgacattgttacacttcttggctgagttgtgtgagaatgactatcctgatgtcctcaag
tttccagacgagcttgcccatgtggagaaagccagccgagtttctgctgaaaacttgcaa
aagaacctagatcagatgaagaaacaaatttctgatgtggaacgtgatgttcagaatttc
ccagctgccacagatgaaaaagacaagtttgttgaaaaaatgaccagctttgtgaaggat
gcacaggaacagtataacaagctgcggatgatgcattctaacatggagaccctctataag
gagctgggcgagtacttcctctttgaccccaagaagttgtctgttgaagaatttttcatg
gatcttcacaattttcggaatatgtttttgcaagcagtcaaggagaaccagaagcggcgg
gagacagaagaaaagatgaggcgagcaaaactagccaaggaaaaggcagagaaggagcgg
ctagagaagcagcagaagagagagcaactcatagacatgaatgcagagggcgatgagaca
ggtgtgatggacagtcttctagaagccctgcagtcaggggcagcattccgacggaagaga
gggccccgtcaagccaacaggaaggccgggtgtgcagtcacatctctgctggcttcggag
ctgaccaaggatgatgccatggccgctgttcctgccaaggtgtccaagaacagtgagaca
ttccccacaatccttgaggaagccaaggagttggttggccgtgcaagctaa

DBGET integrated database retrieval system