KEGG   Pongo abelii (Sumatran orangutan): 100437700Help
Entry
100437700         CDS       T01416                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00020  Citrate cycle (TCA cycle)
pon00190  Oxidative phosphorylation
pon01100  Metabolic pathways
pon01200  Carbon metabolism
pon04714  Thermogenesis
pon04932  Non-alcoholic fatty liver disease (NAFLD)
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05016  Huntington disease
Module
pon_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pon_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pon_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100437700 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    100437700 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    100437700 (SDHB)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    100437700 (SDHB)
   05012 Parkinson disease
    100437700 (SDHB)
   05016 Huntington disease
    100437700 (SDHB)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100437700 (SDHB)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     100437700 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-GeneID: 100437700
NCBI-ProteinID: XP_002811455
Ensembl: ENSPPYG00000001812
UniProt: H2N8W2
LinkDB All DBs
Position
1
AA seq 280 aa AA seqDB search
MAAVVALSLRRRLPATTLGGACLQASRGTQTAAAAAPRIKKFAIYRWDPDKAGDKPHMQT
YEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTN
LNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL
YRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgtggtcgcactctccttgaggcggcggttaccggccacaacccttggcgga
gcctgcctgcaggcctcccgaggaacccagacagctgcagccgcagctccccgtatcaag
aaatttgccatctatcgatgggacccagacaaggctggagacaaacctcatatgcagact
tatgaagttgaccttaataaatgtggccccatggtattagatgctttaatcaagattaag
aatgaagttgactctactttgaccttccgaagatcatgcagagaaggcatctgtggctct
tgtgcaatgaacatcaatggaggcaacactctagcttgcacccgaaggattgacaccaac
ctcaataaggtctcaaaaatctaccctcttccacacatgtatgtgataaaggatcttgtt
cccgatttgagcaacttctatgcacaatacaaatccattgagccttatttgaagaagaag
gatgaatctcaggaaggcaagcagcagtatctgcagtccatagaagagcgtgagaaactg
gacgggctctatgagtgcattctctgtgcctgctgtagcaccagctgccccagctactgg
tggaacggagacaaatatctggggcctgcagttcttatgcaggcctatcgctggatgatt
gactccagagacgacttcacagaggagcgcctggccaagctgcaggacccattctctcta
taccgctgccacaccatcatgaactgcacaaggacctgtcccaagggtctgaatccaggg
aaagctattgcggagatcaagaaaatgatggcaacctataaggagaagaaagcttcagtt
taa

DBGET integrated database retrieval system