KEGG   Pongo abelii (Sumatran orangutan): 100437727
Entry
100437727         CDS       T01416                                 

Gene name
ICAM1
Definition
(RefSeq) intercellular adhesion molecule 1
  KO
K06490  intercellular adhesion molecule 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04064  NF-kappa B signaling pathway
pon04514  Cell adhesion molecules
pon04650  Natural killer cell mediated cytotoxicity
pon04668  TNF signaling pathway
pon04670  Leukocyte transendothelial migration
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05143  African trypanosomiasis
pon05144  Malaria
pon05150  Staphylococcus aureus infection
pon05164  Influenza A
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05169  Epstein-Barr virus infection
pon05323  Rheumatoid arthritis
pon05416  Viral myocarditis
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100437727 (ICAM1)
   04668 TNF signaling pathway
    100437727 (ICAM1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100437727 (ICAM1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100437727 (ICAM1)
   04670 Leukocyte transendothelial migration
    100437727 (ICAM1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100437727 (ICAM1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100437727 (ICAM1)
   05416 Viral myocarditis
    100437727 (ICAM1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100437727 (ICAM1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    100437727 (ICAM1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100437727 (ICAM1)
   05164 Influenza A
    100437727 (ICAM1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100437727 (ICAM1)
   05169 Epstein-Barr virus infection
    100437727 (ICAM1)
  09174 Infectious disease: parasitic
   05144 Malaria
    100437727 (ICAM1)
   05143 African trypanosomiasis
    100437727 (ICAM1)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100437727 (ICAM1)
CD molecules [BR:pon04090]
 Proteins
  100437727 (ICAM1)
Glycosaminoglycan binding proteins [BR:pon00536]
 Hyaluronan
  Cell surface receptors
   100437727 (ICAM1)
Lectins [BR:pon04091]
 I-type lectins (Siglecs)
  100437727 (ICAM1)
SSDB
Motif
Pfam: ICAM_N Ig_2 C2-set_2 ig Ig_3 Adhes-Ig_like
Other DBs
NCBI-GeneID: 100437727
NCBI-ProteinID: XP_002828698
LinkDB
Position
19
AA seq 532 aa
MAPSGPRPALLALLVLLGALFLGPGNAHTSVSPANVFLPRGGSVLVNCSTSCDQPTLLGI
ETPLPKKELLLGGNNWKMYELSNVQEDSQPMCYSNCPDGQSAAKTFLTVYWTPERVELAP
LPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEEELSRQPAVGEPAEVTATVLARKDDH
GANFSCRTELDLRPQGLELFENTSAPHQLQTFVLPATPPQLVSPRVLEVDTQGTVICSLD
GLFPVSEAQVHLALGDQRLNPTVTYGVDSLSAKASVSVTAEEEGTQWLLCAVILGNQSQK
TRQRVTIYSFPAPNVTLTKPEVSEGTEVIVKCEAHPAANVTLNGVPAQPPGPRAQFLLKA
TPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQ
AWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTREVTVNVLSPRYE
IVIITVVAAAAILGTAGLSTYLYNRQRKIRIYRLQQAQKGTPMKPNTQTTPP
NT seq 1599 nt   +upstreamnt  +downstreamnt
atggctcccagcggcccccggcccgcactcctcgcactcctggtcctgctcggggctctg
ttcctaggacctggcaatgcccacacatctgtgtcccccgccaacgtcttcctgccccgg
ggaggctccgtgctagtgaattgcagcacctcctgtgaccagcccaccttgttgggcata
gagaccccgttgcctaaaaaggagttgctcctgggtgggaacaactggaagatgtatgaa
ctgagcaatgtgcaagaagatagccaaccaatgtgctattcaaactgccctgatgggcag
tcagcagctaaaaccttcctcaccgtgtactggactccagaacgggtggaactggcaccc
ctcccctcttggcagccagtgggcaagaaccttaccctacgctgccaggtggagggtggg
gcaccccgggccaacctcaccgtggtattgctccgtggggaggaggagctgagccggcag
ccagcggtgggggagcccgccgaggtcacggccacggtgctggcgaggaaagatgaccac
ggagccaatttctcgtgccgcactgaactggacctgcggccccaagggctggagctgttt
gagaacacctcggccccccaccagctccaaacctttgtcctgccagcgactcccccacaa
cttgtcagcccccgggtcctagaggtggacacgcaggggaccgtgatctgttccctggac
gggctgttcccagtctcggaggcccaggtccacctggcactgggggaccagaggttgaac
cccacagtcacctatggcgtcgactccctctcggccaaggcctcagtcagtgtgaccgca
gaggaggagggcacccagtggctgttgtgtgcagtgatactggggaaccagagccagaag
acacggcagagagtgaccatctacagctttcctgcacccaacgtgactctgacgaagcca
gaggtctcagaagggaccgaggtgatagtgaagtgtgaggcccaccctgcagccaacgtg
acgctgaatggggttccagcccagccgccgggcccgagggcccagttcctgctgaaggcc
accccagaggacaacgggcgcagcttctcctgctctgcaaccctggaggtggccggccag
cttatacacaagaaccagacccgggagcttcgagtcctgtatggcccccgactggacgag
agggattgtccgggaaactggacgtggccagaaaactcccagcagactccaatgtgccag
gcttgggggaaccccttgcccgagctcaagtgtctaaaggatggcactttcccactgccc
atcggggaatcagtgactgtcactcgagatcttgagggcacctacctctgtcgggccagg
agcactcaaggggaggtcacccgcgaggtgaccgtgaatgtgctctccccccggtatgag
attgtcatcatcactgtggtagcagccgcagccatactgggcactgcaggcctcagcacg
tacctctataaccgccagcggaagatcaggatatacagactacaacaggctcaaaaaggg
acccccatgaaaccaaacacacaaaccacgcctccctga

DBGET integrated database retrieval system