KEGG   Pongo abelii (Sumatran orangutan): 100437791
Entry
100437791         CDS       T01416                                 

Gene name
PRKG1
Definition
(RefSeq) cGMP-dependent protein kinase 1 isoform X1
  KO
K07376  cGMP-dependent protein kinase 1 [EC:2.7.11.12]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04022  cGMP-PKG signaling pathway
pon04270  Vascular smooth muscle contraction
pon04540  Gap junction
pon04611  Platelet activation
pon04713  Circadian entrainment
pon04714  Thermogenesis
pon04730  Long-term depression
pon04740  Olfactory transduction
pon04923  Regulation of lipolysis in adipocytes
pon04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100437791 (PRKG1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100437791 (PRKG1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100437791 (PRKG1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100437791 (PRKG1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100437791 (PRKG1)
  09154 Digestive system
   04970 Salivary secretion
    100437791 (PRKG1)
  09156 Nervous system
   04730 Long-term depression
    100437791 (PRKG1)
  09157 Sensory system
   04740 Olfactory transduction
    100437791 (PRKG1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100437791 (PRKG1)
   04714 Thermogenesis
    100437791 (PRKG1)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     100437791 (PRKG1)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: AGC group
  PKG family
   100437791 (PRKG1)
SSDB
Motif
Pfam: Pkinase cNMP_binding PK_Tyr_Ser-Thr Kinase-like Med4 Med28 APH Pkinase_C Spc7 Tsc35 PKcGMP_CC
Other DBs
NCBI-GeneID: 100437791
NCBI-ProteinID: XP_024109092
LinkDB
Position
10
AA seq 686 aa
MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQA
QKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMK
NLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKV
FGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSL
PEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLG
KGDWFGEKALQGEDVRTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKY
EAEAAFFANLKLSDFNIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEH
IRSEKQIMQGAHSDFIVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYT
ACVVEAFAYLHSKGIIYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYV
APEIILNKGHDISADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAK
NAANLIKKLCRDNPSERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTD
TSNFDSFPEDNDEPPPDDNSGWDIDF
NT seq 2061 nt   +upstreamnt  +downstreamnt
atgggcaccttgcgggatttacagtacgcgctccaggagaagatcgaggagctgaggcag
cgggatgctctcatcgacgagctggagctggagttggatcagaaggacgaactgatccag
aagctgcagaacgagctggacaagtaccgctcggtgatccgaccagccacccagcaggcg
cagaagcagagcgcgagcaccttgcagggcgagccgcgcaccaagcggcaggcgatctcc
gccgagcccaccgccttcgacatccaggatctcagccatgtgaccctgcccttctacccc
aagagcccacagtccaaggatcttataaaggaagctatccttgataatgactttatgaag
aacttggagctgtcgcagatccaggagattgtggattgtatgtacccggtggagtatggc
aaggacagttgcatcatcaaagaaggagatgtggggtcactggtgtatgtcatggaagat
ggtaaggttgaagttacaaaagaaggtgtgaagttgtgtaccatgggtccaggaaaagtg
tttggggagttggctattctttacaactgtacccggacagcgaccgtcaagactcttgta
aatgtaaaactctgggccattgatcgacaatgttttcaaacaataatgatgaggacagga
ctcatcaagcataccgagtatatggaatttttaaaaagcgttccaacattccagagcctt
cctgaagagatcctcagcaagctcgctgatgtccttgaagagacccactatgaaaatgga
gaatatattatcaggcaaggtgcaagaggggacaccttctttatcatcagcaaaggaacg
gtaaatgtcactcgtgaagactcaccaagtgaagacccagtctttcttagaactttagga
aaaggagactggtttggagagaaagccttgcagggggaagatgtgagaacagcaaacgta
attgctgcagaagctgtaacctgccttgtgattgacagagactctttcaaacatttgatt
ggagggctggatgatgtttctaataaagcatatgaagatgcagaagctaaagcaaaatat
gaagctgaagcggctttcttcgccaacctgaagctgtctgatttcaacatcattgatacc
cttggagttggaggtttcggacgagtagaactggtccagttgaaaagtgaagaatccaaa
acgtttgcaatgaagattctcaagaaacgtcacattgtggacacaagacagcaggagcac
atccgctcagagaagcagatcatgcagggggctcattccgatttcatagtgagactgtac
agaacatttaaggacagcaaatatttgtatatgttgatggaagcttgtctaggtggagag
ctctggaccattctcagggatagaggttcatttgaagattctacaaccagattttacaca
gcatgtgtggtagaagcttttgcctatctgcattccaaaggaatcatttacagggacctc
aagccagaaaatctcatcctagatcaccgaggttatgccaaactggttgattttggcttt
gcaaagaaaataggatttggaaagaaaacatggactttttgtgggactccagagtatgta
gccccagagatcatcctgaacaaaggccatgacatttcagccgactactggtcactggga
atcctaatgtatgaactcttgactggcagcccacctttctcaggcccagatcctatgaaa
acctataacatcatattgagggggattgacatgatagaatttccaaagaagattgccaaa
aatgctgctaatttaattaaaaaactatgcagggacaatccatcagaaagattagggaat
ttgaaaaatggagtaaaagacattcaaaagcacaaatggtttgagggctttaactgggaa
ggcttaagaaaaggtaccttgacacctcctataataccaagtgttgcatcacccacagac
acaagtaattttgacagtttccctgaggacaacgatgaaccaccacctgatgacaactca
ggatgggacatagacttctaa

KEGG   Pongo abelii (Sumatran orangutan): 100438589
Entry
100438589         CDS       T01416                                 

Gene name
PRKG2
Definition
(RefSeq) cGMP-dependent protein kinase 2 isoform X1
  KO
K19477  cGMP-dependent protein kinase 2 [EC:2.7.11.12]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04022  cGMP-PKG signaling pathway
pon04540  Gap junction
pon04611  Platelet activation
pon04713  Circadian entrainment
pon04714  Thermogenesis
pon04730  Long-term depression
pon04740  Olfactory transduction
pon04923  Regulation of lipolysis in adipocytes
pon04924  Renin secretion
pon04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100438589 (PRKG2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100438589 (PRKG2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100438589 (PRKG2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100438589 (PRKG2)
   04924 Renin secretion
    100438589 (PRKG2)
  09154 Digestive system
   04970 Salivary secretion
    100438589 (PRKG2)
  09156 Nervous system
   04730 Long-term depression
    100438589 (PRKG2)
  09157 Sensory system
   04740 Olfactory transduction
    100438589 (PRKG2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100438589 (PRKG2)
   04714 Thermogenesis
    100438589 (PRKG2)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     100438589 (PRKG2)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: AGC group
  PKG family
   100438589 (PRKG2)
SSDB
Motif
Pfam: Pkinase cNMP_binding PK_Tyr_Ser-Thr Kinase-like RNase_Y_N UPF0242 Crescentin APH FAM76 FeoB_N Spc7 ATG16 MPS2 DUF16
Other DBs
NCBI-GeneID: 100438589
NCBI-ProteinID: XP_002814966
Ensembl: ENSPPYG00000014883
UniProt: A0A6D2W0L5 A0A2J8UUI6
LinkDB
Position
4
AA seq 762 aa
MGNGSVKPKHSKHPDGHSGNLTTDALRNKVTELERELRRKDAEIQEREYHLKELREQLSK
QTVAIAELTEELQNKCIQLNKLQDVVHMQGGSLLQASPDKVPLEVHRKTSGLVSLHSRRG
AKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDM
VECMYGRNYQQGSYIIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNC
TRTASVKAITNVKTWALDREVFQNIMRRTAQARDEQYRNFLRSVSLLKNLPEDKLTKIID
CLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKAL
ISDDVRSANIIAEENDVACLVIDRETFNQTVGTFEELQKYLEGYVANLNRDDEKRHAKRS
MSNWKLSKALSLEMIQLKEKVARFSSSSPFQNLEIIATLGVGGFGRVELVKVKNENVAFA
MKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWS
ILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDAEGYLKLVDFGFAKK
IGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGVDQMMTYN
LILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLK
ARSLPSPLQRELNGPIDHSYFDKYPPEKGMPPDELSGWDKDF
NT seq 2289 nt   +upstreamnt  +downstreamnt
atgggaaatggttcagtgaaacctaaacattccaagcacccagatggacactctgggaac
ctcaccactgatgctctgcggaacaaggtgacagagctggagagagagttgaggaggaag
gatgctgagatccaggaacgggagtaccatttgaaggagctgcgggagcagctgtcgaag
cagactgtggccattgctgaactcacagaggagctccagaacaagtgcatccagctgaac
aagctgcaggatgtggtgcatatgcagggaggaagcctgcttcaggcttctccagataaa
gtgcctcttgaggtccaccggaagacctctggattggtctctctccatagcaggagggga
gcaaaggctggtgtgtctgctgagccaacaacccggacctatgacctgaacaaaccccct
gaattttcctttgagaaagcaagagtcagaaaagactccagtgagaagaagctcattaca
gatgcccttaataaaaatcagtttctgaaaagactggatcctcagcagatcaaagacatg
gtggaatgcatgtatgggagaaactatcagcaagggagttacattattaagcaaggagaa
ccaggaaaccatatctttgtgctggcagagggtcgactagaggtgttccaaggggagaaa
ttgctgtcctccatccctatgtggaccacatttggggagcttgccattttatacaactgt
acaaggactgcctctgtgaaagctattaccaatgttaaaacgtgggcactagatcgagag
gtattccagaatataatgaggagaacagcccaagctagagatgaacaatacagaaacttc
ctcagaagtgtatccttgctgaagaatttacctgaagataaattaaccaagatcattgac
tgcttggaagtggaatactatgacaaaggagattacatcattagagagggcgaggaagga
agtacctttttcattttggcaaaaggaaaggtaaaagtaacacagagcacagaaggccat
gatcaaccacagctgataaaaacactgcagaaaggagaatactttggagaaaaagctctt
atcagtgatgatgtgaggtcagctaacattattgctgaagaaaatgatgttgcatgcctg
gttatagatcgagaaacattcaaccaaactgttggtacatttgaagagctgcaaaaatac
cttgaaggatatgtggcaaacctgaaccgtgatgatgaaaaaagacatgcaaagcgatcc
atgtctaactggaagctgtccaaagcactctctctggaaatgattcagctgaaggagaag
gtggccagattttcctcatcatccccattccagaaccttgagattattgcaacactgggc
gttggtgggttcggaagagttgagcttgttaaagtaaaaaatgagaatgtcgcttttgct
atgaagtgcataaggaagaagcacatagttgacaccaagcagcaggagcatgtctactca
gagaagaggatcctagaggagctgtgctctccattcattgtgaaattatatcgtactttc
aaggacaataagtatgtatacatgcttctggaggcctgcttaggtggggagctatggagt
atattaagggacagaggcagctttgatgaacccacctccaaattctgcgttgcttgtgtg
acagaagcatttgattacctgcatcgactaggtattatctacagagacttgaaaccagaa
aacttaattctagatgctgagggttaccttaaattggttgactttggatttgcgaagaaa
atagggtctggacagaaaacatggacattctgtgggactccagaatatgtagctcctgaa
gtcattctcaacaagggacatgacttcagtgtggatttctggtcactgggaattctagtg
tatgagctcctaacgggcaacccacccttttctggggttgaccaaatgatgacctacaat
ttgattctcaaaggaattgaaaaaatggattttcccaggaagataacacgacgacctgag
gatttgattcggaggctttgcaggcaaaatccaacagaaaggctgggaaatctgaagaat
ggaataaatgacattaagaaacacaggtggttaaatggttttaattgggagggactgaaa
gcacggagccttccatcacctttgcaaagagagctcaatggacccatagatcacagctac
tttgacaaatatcctcctgaaaagggaatgcctccagacgagctatcaggctgggataaa
gacttctga

DBGET integrated database retrieval system