KEGG   Pongo abelii (Sumatran orangutan): 100438186Help
Entry
100438186         CDS       T01416                                 

Gene name
GSTZ1
Definition
(RefSeq) maleylacetoacetate isomerase isoform X2
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00350  Tyrosine metabolism
pon01100  Metabolic pathways
Module
pon_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    100438186 (GSTZ1)
Enzymes [BR:pon01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     100438186 (GSTZ1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_3 GST_C GST_C_2 Tom37
Motif
Other DBs
NCBI-GeneID: 100438186
NCBI-ProteinID: XP_002825017
Ensembl: ENSPPYG00000006021
UniProt: H2NLW5
LinkDB All DBs
Position
14
AA seq 216 aa AA seqDB search
MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVP
ALKIDGITIHQSLAIIEYLEETRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLK
QVGEEIQLTWAQNAITSGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDL
TPYPTISSVNKRLLVLEAFQVSHPCRQPDTPTELRA
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcggggaagcccatcctctattcctatttccgaagctcctgctcatggagagtt
cgaattgctctggccttgaaaggcatcgactacgagacggtgcccatcaatctcataaag
gatgggggccaacagttctctaaggacttccaggcactgaatcccatgaagcaggtgcca
gccctgaagattgatggaatcaccattcaccagtcactggccatcattgagtatctagag
gagacgcgtcccactccgcgacttctgcctcaggacccaaagaagagggccagcgtgcgt
atgatttctgacctcatcgctggtggcatccagcccctgcagaacctgtctgtcctgaag
caagtgggagaggagatccagctgacctgggcccagaacgccatcacttctggctttaac
gccctggagcagatcctacagagcacagcgggcatatactgtgtaggagacgaggtgacc
atggctgatctgtgcttggtgcctcaggtggcaaatgctgaaagattcaaggtggatctc
accccctaccctaccatcagctccgtcaacaagaggctgctggtcttggaggccttccag
gtgtctcacccctgccggcagccagatacacccaccgagctgagggcctag

DBGET integrated database retrieval system