KEGG   Pongo abelii (Sumatran orangutan): 100438192
Entry
100438192         CDS       T01416                                 

Gene name
PKN2
Definition
(RefSeq) serine/threonine-protein kinase N2 isoform X1
  KO
K23691  serine/threonine-protein kinase N2 [EC:2.7.11.13]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04621  NOD-like receptor signaling pathway
pon05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100438192 (PKN2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100438192 (PKN2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100438192 (PKN2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100438192 (PKN2)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100438192 (PKN2)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: AGC group
  PKN family
   100438192 (PKN2)
SSDB
Motif
Pfam: Pkinase HR1 PK_Tyr_Ser-Thr Pkinase_C Kinase-like Uds1 C2
Other DBs
NCBI-GeneID: 100438192
NCBI-ProteinID: XP_024111495
LinkDB
Position
1
AA seq 984 aa
MASNPEGGEILLTELQGDSRSLPFSENVSAVQKLDFSDTMVQQKLDDIKDRIKREIRKEL
KIKEGAENLRKVTTDKKSLAYVDNILKKSNKKLEELHHKLQELNAHIVVSDPEDITDCPR
TPDTPNSDPRCSTSNNRLKALQKQLDIELKVKQGAENMIQMYSNGSSKDRKLHGTAQQLL
QDSKTKIEVIRMQILQAVQTNELAFDNAKPVISPLELRMEELRHHFRIEFAVAEGAKNVM
KLLGSGKVTDRKALSEAQARFNESSQKLDLLKYSLEQRLNELPKNHPKSSIIIEELSLVA
ASPTLSPRQSMISTQNQYSTLSKPAALTGTLEVRLMGCQDILENVPGRSKATSVALPGWS
PSETRSSFMSRTSKSKSGSSRNLLKTDDLSNDVCAVLKLDNTVVGQTSWKPISNQSWDQK
FTLELDRSRELEISVYWRDWRSLCAVKFLRLEDFLDNQRHGMCLYLEPQGTLFAEVTFFN
PVIERRPKLQRQKKIFSKQQGKTFLRAPQMNINIATWGRLVRRAIPTVNHSGTFSPQAPV
PTTVPVVDVRIPELAPPASDSTVTKLDFDLEPEPPPAPPRASSLGEIDESSELRVLDTPG
QDSETVFDIENDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNLQDFRCC
AVLGRGHFGKVLLAEYKHTNEMFAIKALKKGDIVARDEVDSLMCEKRIFETVNSVRHPFL
VNLFACFQTKEHVCFVMEYAAGGDLMMHIHTDVFSEPRAVFYAACVVLGLQYLHEHKIVY
RDLKLDNLLLDTEGFVKIADFGLCKEGMGYGDRTSTFCGTPEFLAPEVLTETSYTRAVDW
WGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAISIMRRLLRRNPERRL
GASEKDAEDVKKHPFFRLIDWSALMDKKVKPPFIPTIRGREDVSNFDDEFTSEAPILTPP
REPRILSEEEQEMFRDFDYIADWC
NT seq 2955 nt   +upstreamnt  +downstreamnt
atggcgtccaaccccgaagggggggagattctgctcacggaactgcagggggattcccga
agtcttccgttttctgagaacgtgagtgctgttcaaaaattagacttttcagatacaatg
gtgcagcagaaattggatgatatcaaggatcgaattaagagagaaataaggaaagaactg
aaaatcaaagaaggagctgaaaatctgaggaaagtcacaacagataaaaaaagtttggct
tacgtagacaacattttgaaaaaatcaaataaaaaattagaagaactacatcacaagctg
caggaattaaatgcacatattgttgtatcagatccagaagatattacagattgcccaagg
actccagatactccaaatagtgaccctcgttgttctactagcaacaatagattgaaggct
ctacaaaaacaattggatatagaacttaaagtaaaacaaggtgcagagaatatgatacag
atgtattcaaatggatcttcaaaggatcggaaactccatggtacagctcagcaactgctc
caggacagcaagacaaaaatagaagtcatacgaatgcagattcttcaggcagtccagact
aatgaattggcttttgataatgcaaaacctgtgataagtcctcttgaacttcggatggaa
gaattaaggcatcattttaggatagagtttgcagtagcagaaggtgcaaagaatgtaatg
aaattacttggctcaggaaaagtaacagacagaaaagcactttcggaagctcaagcaaga
tttaatgaatcaagtcagaagttggaccttttaaagtattcattagagcaaagattaaat
gaactacccaagaatcatcccaaaagcagtattattattgaagaactttcacttgttgct
gcatcaccaacactaagtccacgtcaaagtatgatatctacacaaaatcaatatagtaca
ctatccaaaccagcagcattaacaggtactttggaagttcgtcttatgggctgccaagat
atcctagagaatgtccctggacggtcaaaagcaacatcagttgcactgcctggttggagt
ccaagtgaaaccagatcatctttcatgagcagaacgagtaaaagtaaaagcggaagtagt
cgaaatcttctaaaaaccgatgacttgtccaatgatgtctgtgctgttttgaagctcgat
aatactgtggttggccaaactagctggaaacccatttccaatcagtcatgggaccagaag
tttacactggaactggacaggtcacgtgaactggaaatttcagtttattggcgtgattgg
cggtctctgtgtgctgtaaaatttctgaggttagaagattttttagacaaccaacggcat
ggcatgtgtctctatttggaaccacagggtactttatttgcagaggttaccttttttaat
ccagttattgaaagaagaccaaaacttcaaagacaaaagaaaattttctcaaagcaacaa
ggcaaaacatttctcagagctcctcaaatgaatattaatattgccacttggggaaggcta
gtaagaagagctattcctacagtaaatcattctggcaccttcagccctcaagctcctgtg
cctactacagtgccagtggttgatgtacgcatccctgaactagcacctccagctagtgat
tctacagtaaccaaattggacttcgatcttgagcctgaacctcctccagccccaccacga
gcttcctcccttggagaaatagatgaatcttctgaattaagagttttggatacaccagga
caggattcagagactgtttttgatattgagaatgacagaaatagtatacttccaaaatct
caatctgaatacaagcctgatactcctcagtcaggcctagaatatagtggtattcaagaa
cttgaggatagaagatctcagcaaaggtttcagtttaatctacaagatttcaggtgttgt
gctgtcttgggaagaggacattttggaaaggtgcttttagctgaatataaacacacaaat
gagatgtttgctataaaagccttaaagaaaggagatatcgtggctcgagatgaagtagac
agcctgatgtgtgaaaaaagaatttttgaaactgtgaatagtgtaaggcatccctttttg
gtgaacctttttgcatgtttccaaaccaaagagcatgtttgctttgtaatggaatatgct
gccggtggggacctaatgatgcacattcatactgatgtcttttctgaaccaagagctgta
ttttatgctgcttgtgtagttcttgggttgcagtatttacatgaacacaaaattgtttat
agagatttgaaattggataacttattgctagatacagagggctttgtgaaaattgctgat
tttggtctttgcaaagaaggaatgggatatggagatagaacaagcacattttgtggcact
cctgaatttcttgccccagaagtattaacagaaacttcttacacaagggctgtagattgg
tggggccttggcgtgcttatatatgaaatgcttgttggtgagtctccctttcctggtgat
gatgaagaggaagtttttgacagtattgtaaatgatgaagtaaggtatccaaggttctta
tctacagaagccatttctataatgagaaggctgttaagaagaaatcctgagcggcgcctt
ggggctagtgagaaagatgcagaggatgtaaaaaagcacccatttttccggctaattgat
tggagtgctctgatggacaaaaaagtaaagccaccatttatacctaccataagaggacga
gaagatgttagtaattttgatgatgaatttacctcagaagcacctattctgactccacct
cgagaaccaaggatactttcggaagaggagcaggaaatgttcagagattttgactacatt
gctgattggtgttaa

KEGG   Pongo abelii (Sumatran orangutan): 100440176
Entry
100440176         CDS       T01416                                 

Gene name
PKN1
Definition
(RefSeq) LOW QUALITY PROTEIN: serine/threonine-protein kinase N1
  KO
K06071  serine/threonine-protein kinase N1 [EC:2.7.11.13]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04621  NOD-like receptor signaling pathway
pon05132  Salmonella infection
pon05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100440176 (PKN1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    100440176 (PKN1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100440176 (PKN1)
   05135 Yersinia infection
    100440176 (PKN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100440176 (PKN1)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100440176 (PKN1)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: AGC group
  PKN family
   100440176 (PKN1)
SSDB
Motif
Pfam: Pkinase HR1 PK_Tyr_Ser-Thr Pkinase_C Kinase-like PL48 Uds1 C2
Other DBs
NCBI-GeneID: 100440176
NCBI-ProteinID: XP_002828841
Ensembl: ENSPPYG00000009643
LinkDB
Position
19
AA seq 943 aa
MASDAVQSEPHSWSLLEQLGLAGADLAAPGVQQQLELERERLRREIRKELKLKEGAENLR
RATTDLGRSLGPVELLLRGSSRRLDLLHQQLQELHAHVVLPDPAATHDGPQSPGAGGPTC
SATNLSRVAGLEKQLAIELKVKQGAENMIQTYSNGSTKDRKLLLTAQQMLQDSKTKIDII
RMQLRRALQAGQLENQAAPDETQGSPDLGAVELRIEELRHHFRVEHAVAEGAKNVLRLLS
AAKAPDRKAVSEAQEKLTESNQKLGLLREALERRLGELPADHPKGRLLREELAAASSAAF
SARLAGPFPATHYSTLCKPAPLTGTLEVRVVGCRDLPETIPWNPTPPVGGPGTPDSRPPF
LSRPARGLYSRSGSLSGRSSLKAEAENTSEVSTVLKLDNTVVGQTSWKPCGPNAWDQSFT
LELERARELELAVFWRDQRGLCALKFLKLEDFLDNERHEVQLDMEPQGCLVAEVTFRNPV
IERIPRLQRQKKIFSKQQGKAFQRARQMNIDVATWVRLLRRLIPNATATGTFSPGASPGS
EARTTGDISVEKLNLGTDSDSSPQKSSRDPPSSPSSLSSPIQESSTTPELPSETQETPGP
ALCSPLRKSPLTLEDFKFLAVLGRGHFGKVLLSEFRPSGELFAIKALKKGDIVARDEVES
LMCEKRILAAVTSAGHPFLVNLFGCFQTPEHVCFVMEYSAGGDLMLHIHSDVFSEPRAVF
YSACVVLGLQFLHEHKIVYRDLKLDNLLLDTEGYVKIADFGLCKEGMGYGDRTSTFCGTP
EFLAPEVLTDTSYTRAVDWWGLGVLLYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLS
AEAIGIMRRLLRRNPERRLGSSERDAEDVKKQPFFRTLGWEALLARRLPPPFVPTLSGRT
DVSNFDEEFTGEXPTLSPPRDARPLTAGEQAAFLDFDFVAGGC
NT seq 2832 nt   +upstreamnt  +downstreamnt
atggccagcgacgccgtgcagagtgagcctcacagctggtccctgctagagcagctgggc
ctggccggggcagacctggcggcccccggggtacagcagcagctggagctggagcgggaa
cggctgcggcgggaaatccgcaaggagctgaagctgaaggagggtgctgagaacctgcgg
cgggccaccactgacctgggccgcagcctgggccccgtggagctgctgctgcggggctcc
tcgcgccgcctcgacctgctgcaccagcagctgcaggagctgcacgcccatgtggtgctt
cccgacccggcggccacccacgatggcccccagtcccctggtgcgggcggccccacctgc
tcggccaccaacctgagccgcgtggcgggcctggagaagcagttggccattgagctgaag
gtgaagcagggggcggagaacatgatccagacctacagcaatggcagcaccaaggaccgg
aagctgctgctgacagcccagcagatgttgcaggacagtaagaccaagattgacatcatc
cgcatgcaactccgccgggcgctgcaggccggccagctggagaaccaggcagccccggat
gagacccaagggagtcctgacctgggggctgtggagctgcgcatcgaagagctgcgtcac
cacttccgagtggagcacgcggtggccgagggtgccaagaacgtactgcgcctgctcagt
gctgccaaggccccggaccgcaaggcagtcagcgaggcccaggagaaattgacagaatcc
aaccagaagctggggctgctgcgggaagctctggagcggagacttggggagctgcccgcc
gaccaccccaaggggcggctgctgcgagaagagctcgctgcggcctcgtctgccgccttc
agcgcccgcctggccgggccctttcccgccacgcactacagcaccctgtgcaagcccgcg
ccgctcacagggaccctggaggtacgcgtggtgggctgcagagacctcccagagaccatc
ccctggaaccctacgccccccgtggggggacctgggaccccagacagccgccccccattc
ctgagccgcccagctcggggcctttacagccgaagcggaagcctcagtggccggagcagc
ctcaaagcagaagccgagaacaccagtgaagtcagcactgtgcttaagctggataacaca
gtggtggggcagacgtcttggaagccatgtggccccaatgcctgggaccagagcttcact
ctggagctggagagggcacgggaactggagttggctgtgttctggcgggaccagcggggc
ctgtgtgccctcaaattcctgaagttggaggatttcttggacaatgagaggcatgaggtg
cagctggacatggaaccccagggctgcctggtggccgaggtcactttccgcaaccctgtc
attgaaaggattccgcggctccaacggcagaagaaaattttctccaagcagcaagggaag
gcgttccagcgtgctaggcagatgaacatcgatgtcgccacgtgggtgcggctgctccgg
aggctcatccccaatgccacggccacaggcaccttcagccctggggcttctccgggatcc
gaggcccggaccacaggtgacatatcggtggagaagctgaacctcggcactgactcggac
agctcacctcagaagagctcgcgggatcctccttccagcccatcgagcctgagctccccg
atccaggaatcctccaccactcctgagctgccttcggagacccaggagaccccaggcccc
gccctgtgcagccctctgaggaagtcacctctgaccctcgaagatttcaagttcctggca
gtgctgggccggggtcattttgggaaggtgctgctctccgaattccggcccagtggggag
ctgtttgccatcaaggctctgaagaaaggggacattgtggcccgagacgaggtggagagc
ctgatgtgtgagaagcggatattggcagcagtgaccagcgcaggacaccccttcctggtg
aacctcttcggctgtttccagacaccggagcacgtgtgcttcgtgatggagtactcggct
ggtggagacctgatgctgcacatccacagcgacgtgttctctgagccccgtgccgtcttt
tattccgcctgcgtggtgctgggcctacagtttcttcacgaacacaagatcgtctacagg
gacctgaagttggacaatttgctcctggacaccgagggctacgtcaagatcgcagacttt
ggcctctgcaaggaggggatgggctatggggaccggaccagcaccttctgtgggaccccg
gagttcctggcccctgaggtgctgacggacacgtcatacactcgggctgtggactggtgg
gggctgggtgtgctgctctacgagatgctggttggtgagtccccattcccaggggatgac
gaggaggaggtcttcgatagcatcgtcaacgacgaggttcgctatcctcgcttcctgtcg
gccgaagccatcggcatcatgagaaggctgctgcggaggaacccagagcggaggctggga
tctagcgagagagatgcagaagatgtgaaaaaacagcccttcttcaggactctgggctgg
gaagccctgttggcccggcgcctgccaccgccctttgtgcccacgctgtccggccgcacc
gacgtcagcaacttcgacgaggagttcaccggggagngccccacactgagcccgccgcgc
gacgcgcggcccctcacagccggggagcaggcagccttcctggacttcgacttcgtggcc
gggggctgctag

KEGG   Pongo abelii (Sumatran orangutan): 100450739
Entry
100450739         CDS       T01416                                 

Gene name
PKN3
Definition
(RefSeq) serine/threonine-protein kinase N3 isoform X2
  KO
K23692  serine/threonine-protein kinase N3 [EC:2.7.11.13]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100450739 (PKN3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100450739 (PKN3)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100450739 (PKN3)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: AGC group
  PKN family
   100450739 (PKN3)
SSDB
Motif
Pfam: Pkinase HR1 PK_Tyr_Ser-Thr Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 100450739
NCBI-ProteinID: XP_002820312
LinkDB
Position
9
AA seq 889 aa
MEEGAPRQPGPSQWPPEDEKEVIRRAIQKELKIKEGVENLRRAATDRRHLSHVQQLLRSS
NRRLEQLHGELRELHARILLPGPGPGPAEPVASGPRPWAEQLRARHLEALRRQLHVELKV
KQGAENMTHTCASGTPKERKLLAAAQQMLRDSQLKVALLRMKISSLEASGSPEPGPELLA
EELQHRLHVEAAVAEGAKNVVKLLSSRRTQDRKALAEAQAQLQESSQKLDLLRLALEQLL
EQLPPAHPLRSRVARELRTAVPGYPQPSGTPVKPTALTGTLQVRLLGCEQLLTAVPGRSP
AAALASSPSEGWLWTRAKHQRGRGELASEVLAVLKVDNRVVGQTGWGQVAEQSWDQTFVI
PLERARELEIGVHWRDWRQLCGVAFLRLEDFLDNACHQLSLSLVPQGLLFAQVTFCDPVI
ERRPRLQRQERIFSKRRGQDFLRASQMNLGMAAWGRLVMNLLPPCSSPSITSPPKGCPRT
PTTPREASDPATPSNFLPKKTPLGEEMMPPPKPPRLYLPQEPTSEETPRTKRPHMEARTR
RGPSPPASPTRKPPRLQDFRCLAVLGRGHFGKVLLVQFKGTGKYYAIKALKKQEVLSRDE
IESLYCEKRILEAVGRTGHPFLLSLLACFQTSSHACFVTEFVPGGDLMMQIHEDVFPEPQ
ARFYVACVVLGLQFLHEKKIIYRDLKLDNLLLDAQGFLKIADFGLCKEGIGFGDRTSTFC
GTPEFLAPEVLTQEAYTRAVDWWGLGVLLYEMLVGECPFPGDTEEEVFDCIVNMDAPYPG
FLSVQGLELIQKLLQKCPEKRLGAGEQDAEEIKVQPFFRTTNWQALLARTIQPPFVPTLC
GPADLRYFEGEFTGLPPALTPPAPHSLLTARQQAAFQDFDFVSERFLEP
NT seq 2670 nt   +upstreamnt  +downstreamnt
atggaggagggggcgccgcggcagcctgggccgagccagtggcccccagaggatgagaaa
gaggtgatccgtcgggccatccagaaagagctgaagatcaaggagggggtggagaacctg
cggcgcgcggccacagaccgccgccacttgagccatgtgcagcagctgctgcggtcctcc
aaccgccgcctggagcagctgcatggcgagctgcgggagctgcatgcccgaatcctgctg
cccggccctgggcctggcccagctgagcctgtggcctcaggaccccggccgtgggcagag
cagctcagggctcggcacctagaggctctccggaggcagctgcatgtggagctgaaggtg
aagcagggggctgagaacatgacccacacgtgcgccagtggcacccccaaggagaggaag
ctcctggcagccgcccagcagatgctgcgggacagccagctgaaggtggccctgctgcgg
atgaagatcagcagcttggaggccagtgggtccccggagccagggcctgagctgctggcg
gaggagctacagcatcgactgcacgttgaggcagctgtggctgagggcgccaagaacgtg
gtgaaactgcttagtagccggagaacacaggaccgcaaggcactggctgaggcccaggcc
cagctacaggagtcctcccagaaactggacctcctgcggctggccttggagcagctgctg
gagcaactgcctcctgcccaccctttgcgcagcagagtggcccgagagttgcggactgcg
gtgcctggatacccccagccttcagggacacctgtgaagcccaccgccctgacagggaca
ctgcaggtccgcctcctgggctgtgaacagttgctgacagccgtgcccgggcgctcccca
gcggctgcactggccagcagcccctccgagggctggctttggaccagggccaagcaccag
cgtggccgaggcgagcttgccagcgaggtgctggctgtgctaaaggtggacaaccgtgtc
gtggggcagacgggctgggggcaggtggccgaacagtcctgggaccagacctttgtcatc
ccactggagcgagcccgtgagctggagattggggtgcactggcgggactggcggcagcta
tgtggcgtggccttcctgagacttgaggacttcctggacaatgcctgtcaccaactgtcc
ctcagcctggtaccgcagggactgctttttgcccaggtgaccttctgcgatcctgtcatt
gagaggcggccccggctgcagaggcaggaacgaatcttctctaaacgcagaggccaggat
ttcctgagggcttcgcagatgaacctcggcatggcggcctgggggcgcctcgtcatgaac
ctgctgcccccctgcagctcaccgagcataaccagcccccccaaagggtgccctcggacc
ccaacaacaccgcgagaggcctctgaccctgccactcccagtaatttcctgcccaagaag
acccccttgggcgaagagatgatgcccccacccaagcccccgcgcctctacctcccccag
gagccaacatccgaggagactccgcgcaccaaacgtccccatatggaggctaggactcga
cgtgggccatctccaccagcctcccccaccaggaaaccccctcggcttcaggacttccgc
tgcttagctgtgctgggccggggacactttgggaaggtcctcctggtccagttcaagggg
acagggaaatactacgccatcaaagcactgaagaagcaggaggttctcagccgggacgag
atagagagcctgtactgcgagaagcggatcctggaggctgtgggccgcacagggcaccct
ttcctgctctccctccttgcctgcttccagacctccagccatgcctgctttgtgactgag
tttgtgcctggtggcgacctcatgatgcagatccacgaggatgtcttccccgagccgcag
gcccgcttctacgtggcttgtgttgtcctggggctgcagttcttacacgagaagaagatc
atttacagggacctgaagttggataaccttctgctggatgcccagggattcctgaagatt
gcagactttggactctgcaaggaagggatcggcttcggggaccggactagcaccttctgt
ggcaccccggagttcctggctcctgaggtgctgacccaggaggcgtatacacgggctgtg
gactggtgggggctgggtgtgctgctctacgagatgctggtgggtgagtgcccgttccca
ggggacacagaggaagaggtgtttgactgcattgttaacatggacgccccctaccccggc
tttctgtcagtgcaagggcttgagctcattcagaagctcctccagaagtgcccggagaag
cgcctcggggcgggtgagcaggatgccgaggagatcaaggtccagccattcttcaggacc
accaactggcaagccctgctcgcccgcaccatccagccccccttcgtgcctaccctctgt
ggccctgcggacctgcgctactttgagggcgagttcacagggctgccgcctgccctgacc
ccacctgcaccccacagcctcctcactgcccgccaacaggccgccttccaggacttcgac
tttgtgtcagagcgattcctggaaccctga

DBGET integrated database retrieval system