KEGG   Pongo abelii (Sumatran orangutan): 100438199
Entry
100438199         CDS       T01416                                 

Gene name
CDC42
Definition
(RefSeq) cell division control protein 42 homolog
  KO
K04393  cell division control protein 42
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04062  Chemokine signaling pathway
pon04144  Endocytosis
pon04360  Axon guidance
pon04370  VEGF signaling pathway
pon04510  Focal adhesion
pon04520  Adherens junction
pon04530  Tight junction
pon04660  T cell receptor signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04670  Leukocyte transendothelial migration
pon04722  Neurotrophin signaling pathway
pon04810  Regulation of actin cytoskeleton
pon04912  GnRH signaling pathway
pon04932  Non-alcoholic fatty liver disease
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05100  Bacterial invasion of epithelial cells
pon05132  Salmonella infection
pon05135  Yersinia infection
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05205  Proteoglycans in cancer
pon05211  Renal cell carcinoma
pon05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100438199 (CDC42)
   04014 Ras signaling pathway
    100438199 (CDC42)
   04015 Rap1 signaling pathway
    100438199 (CDC42)
   04370 VEGF signaling pathway
    100438199 (CDC42)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100438199 (CDC42)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100438199 (CDC42)
   04520 Adherens junction
    100438199 (CDC42)
   04530 Tight junction
    100438199 (CDC42)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100438199 (CDC42)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100438199 (CDC42)
   04666 Fc gamma R-mediated phagocytosis
    100438199 (CDC42)
   04670 Leukocyte transendothelial migration
    100438199 (CDC42)
   04062 Chemokine signaling pathway
    100438199 (CDC42)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100438199 (CDC42)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100438199 (CDC42)
  09158 Development and regeneration
   04360 Axon guidance
    100438199 (CDC42)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100438199 (CDC42)
   05205 Proteoglycans in cancer
    100438199 (CDC42)
   05203 Viral carcinogenesis
    100438199 (CDC42)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100438199 (CDC42)
   05211 Renal cell carcinoma
    100438199 (CDC42)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100438199 (CDC42)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100438199 (CDC42)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100438199 (CDC42)
   05135 Yersinia infection
    100438199 (CDC42)
   05100 Bacterial invasion of epithelial cells
    100438199 (CDC42)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100438199 (CDC42)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100438199 (CDC42)
   03036 Chromosome and associated proteins [BR:pon03036]
    100438199 (CDC42)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100438199 (CDC42)
   04031 GTP-binding proteins [BR:pon04031]
    100438199 (CDC42)
Membrane trafficking [BR:pon04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    100438199 (CDC42)
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    100438199 (CDC42)
  Macropinocytosis
   Ras GTPases
    100438199 (CDC42)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    100438199 (CDC42)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100438199 (CDC42)
  Exosomal proteins of breast milk
   100438199 (CDC42)
GTP-binding proteins [BR:pon04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    100438199 (CDC42)
SSDB
Motif
Pfam: Ras Roc Arf PET117 GTP_EFTU
Other DBs
NCBI-GeneID: 100438199
NCBI-ProteinID: XP_002811380
Ensembl: ENSPPYG00000001755
UniProt: A0A6D2WT31 A0A2J8T2N4
LinkDB
Position
1
AA seq 191 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagacaattaagtgtgttgttgtgggcgatggtgctgttggtaaaacatgtctcctg
atatcctacacaacaaacaaatttccatcggaatatgtaccgactgtttttgacaactat
gcagtcacagttatgattggtggagaaccatatactcttggactttttgatactgcaggg
caagaggattatgacagattacgaccgctgagttatccacaaacagatgtatttctagtc
tgtttttcagtggtctctccatcttcatttgaaaatgtgaaagaaaagtgggtgcctgag
ataactcaccactgtccaaagactcctttcttgcttgttgggactcaaattgatctcaga
gatgacccctctactattgagaaacttgccaagaacaaacagaagcctatcactccagag
actgctgaaaagctggcccgtgacctgaaggctgtcaagtatgtggagtgttctgcactt
acacagaaaggcctaaagaatgtatttgacgaagcaatattggctgccctggagcctcca
gaaccgaagaagagccgcaggtgtgtgctgctatga

DBGET integrated database retrieval system