KEGG   Pongo abelii (Sumatran orangutan): 100438282
Entry
100438282         CDS       T01416                                 

Gene name
CCNE2
Definition
(RefSeq) G1/S-specific cyclin-E2 isoform X1
  KO
K06626  G1/S-specific cyclin-E1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04110  Cell cycle
pon04114  Oocyte meiosis
pon04115  p53 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04218  Cellular senescence
pon04934  Cushing syndrome
pon05161  Hepatitis B
pon05162  Measles
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05169  Epstein-Barr virus infection
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05206  MicroRNAs in cancer
pon05215  Prostate cancer
pon05222  Small cell lung cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100438282 (CCNE2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100438282 (CCNE2)
   04114 Oocyte meiosis
    100438282 (CCNE2)
   04115 p53 signaling pathway
    100438282 (CCNE2)
   04218 Cellular senescence
    100438282 (CCNE2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100438282 (CCNE2)
   05206 MicroRNAs in cancer
    100438282 (CCNE2)
   05203 Viral carcinogenesis
    100438282 (CCNE2)
  09162 Cancer: specific types
   05226 Gastric cancer
    100438282 (CCNE2)
   05215 Prostate cancer
    100438282 (CCNE2)
   05222 Small cell lung cancer
    100438282 (CCNE2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100438282 (CCNE2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100438282 (CCNE2)
   05161 Hepatitis B
    100438282 (CCNE2)
   05162 Measles
    100438282 (CCNE2)
   05169 Epstein-Barr virus infection
    100438282 (CCNE2)
   05165 Human papillomavirus infection
    100438282 (CCNE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pon03032]
    100438282 (CCNE2)
   03036 Chromosome and associated proteins [BR:pon03036]
    100438282 (CCNE2)
DNA replication proteins [BR:pon03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100438282 (CCNE2)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100438282 (CCNE2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100438282
NCBI-ProteinID: XP_024106575
Ensembl: ENSPPYG00000018757
LinkDB
Position
8
AA seq 426 aa
MSRRSSRLQAKQQPQPSQTESPQEAQIIQAKKRKTTQDVKKRREEVTKKHQYEIRRSAGR
RLSLGGFYVPESYYSCRNCWPPVLSGGISPCLIIETPHKEIGTSDFSRFTNYRFKNLFIN
PSPLPDLSWGCSKEVWLNMLKKESRYVHDKHFEVLHSDLEPQMRSILLDWLLEVCEVYTL
HRETFYLAQDFFDRFMLTQKDINKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGAC
SEEDILRMELIILKALKWELCPVTIISWLNLFLQVDALKDAPKVLLPQYSQETFIQIAQL
LDLCILAIDSLEFQYRILTAAALCHFTSVEVVKKASGLEWDSISECVDWMVPFVNVVKST
SPVKLKTFKKIPMEDRHNIQTHTNYLAMLEEVNYINTFRKGGQLSPVCNGGIMTPPKSTE
KPPGKH
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgtcaagacgaagtagccgtttacaagctaagcagcagccccagcccagccagacggaa
tccccccaagaagcccagataatccaggccaagaagaggaaaactacccaggatgtcaaa
aaaagaagagaggaggtcaccaagaaacatcagtatgaaattaggaggtcagcaggaagg
cgcttatctttgggtggtttctatgtgcccgaatcctactacagctgcagaaattgttgg
ccacctgtattatctggggggatcagtccttgccttatcattgaaacacctcacaaagaa
ataggaacaagtgatttctccagatttacaaattacagatttaaaaatctttttattaat
ccttcgcctttgcctgatttaagctggggatgttcaaaagaagtctggctaaacatgtta
aaaaaggagagtagatatgttcatgacaaacattttgaagttctgcattctgacttggaa
ccacagatgaggtccatacttctagactggcttttagaggtatgtgaagtatacacactt
catagggaaacattttatcttgcacaagacttttttgatagatttatgttgacacaaaag
gatataaataaaaatatgcttcaactcattggaattacctcattattcattgcttccaaa
cttgaggaaatctatgctcctaaactccaagagtttgcttatgtcactgatggtgcttgc
agtgaagaggatatcttaaggatggaactcattatattaaaggctttaaaatgggaactt
tgtcctgtaacaatcatctcctggctaaatctctttctccaagtggatgctcttaaagat
gctcctaaagttcttctacctcagtattctcaggaaacattcattcaaatagctcagctt
ttagatctgtgtattctagccattgattcattagagttccagtacagaatactgactgct
gctgctttgtgccattttacctccgttgaagtggttaagaaagcctcaggtttggagtgg
gacagtatttcagaatgtgtagattggatggtaccttttgtcaatgtagtaaaaagtact
agtccagtgaagctgaagacttttaagaagattcctatggaagacagacataatatccag
acacatacaaactatttggctatgctggaagaagtaaattacataaacaccttcagaaaa
gggggacagttgtcaccagtgtgcaatggaggcattatgacaccaccgaagagcaccgaa
aaaccaccaggaaaacactaa

KEGG   Pongo abelii (Sumatran orangutan): 100461587
Entry
100461587         CDS       T01416                                 

Gene name
CCNE1
Definition
(RefSeq) G1/S-specific cyclin-E1 isoform X1
  KO
K06626  G1/S-specific cyclin-E1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04110  Cell cycle
pon04114  Oocyte meiosis
pon04115  p53 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04218  Cellular senescence
pon04934  Cushing syndrome
pon05161  Hepatitis B
pon05162  Measles
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05169  Epstein-Barr virus infection
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05206  MicroRNAs in cancer
pon05215  Prostate cancer
pon05222  Small cell lung cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100461587 (CCNE1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100461587 (CCNE1)
   04114 Oocyte meiosis
    100461587 (CCNE1)
   04115 p53 signaling pathway
    100461587 (CCNE1)
   04218 Cellular senescence
    100461587 (CCNE1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100461587 (CCNE1)
   05206 MicroRNAs in cancer
    100461587 (CCNE1)
   05203 Viral carcinogenesis
    100461587 (CCNE1)
  09162 Cancer: specific types
   05226 Gastric cancer
    100461587 (CCNE1)
   05215 Prostate cancer
    100461587 (CCNE1)
   05222 Small cell lung cancer
    100461587 (CCNE1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100461587 (CCNE1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100461587 (CCNE1)
   05161 Hepatitis B
    100461587 (CCNE1)
   05162 Measles
    100461587 (CCNE1)
   05169 Epstein-Barr virus infection
    100461587 (CCNE1)
   05165 Human papillomavirus infection
    100461587 (CCNE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pon03032]
    100461587 (CCNE1)
   03036 Chromosome and associated proteins [BR:pon03036]
    100461587 (CCNE1)
DNA replication proteins [BR:pon03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    100461587 (CCNE1)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    100461587 (CCNE1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 100461587
NCBI-ProteinID: XP_024094115
Ensembl: ENSPPYG00000009808
LinkDB
Position
19
AA seq 410 aa
MPRERRERDAKERDTMKEDGGAEFSARSRKRKANVAVFLQDPDEEMAKIDRTARDQCGSQ
PWDNNAVCADPCSLIPTPDKEDDERVYPNSTCKSRIIAPSRGSPLPVLSWANREEVWKIM
LNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQ
ENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWR
LSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILA
ASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIREMGSSKLKHFRGVADEDAHNI
QTHRDSLDLLDKARAKKVMLSEQNRASPLPSGLLTPPQSGKKQSSGPEMA
NT seq 1233 nt   +upstreamnt  +downstreamnt
atgccgagggagcgcagggagcgggatgcgaaggagcgggacaccatgaaggaggacggc
ggcgcggagttctcggctcgctccaggaagaggaaggcaaacgtggccgtttttttgcag
gatccagatgaagaaatggccaaaatcgacaggacggcgagggaccagtgtggaagccag
ccttgggacaataatgcagtctgtgcagacccctgctccctgatccccacacctgacaaa
gaagatgatgagcgggtttacccaaactcaacgtgcaagtctcggattattgcaccatcc
agaggctccccactgcctgtactgagctgggcaaatagagaggaagtctggaaaatcatg
ttaaacaaggaaaagacatacttaagggatcagcactttcttgagcaacaccctcttctg
cagccaaaaatgcgagcaattcttctggattggttaatggaggtgtgtgaggtctataaa
cttcacagggagaccttttacttggcacaagatttctttgaccggtatatggcgacacaa
gaaaatgttgtaaaaactcttctacagcttattggtatttcatctttatttattgcagcc
aaacttgaggaaatctatcctccaaagttgcaccagtttgcgtatgtgacagatggagct
tgttcaggagatgaaattctcaccatggaattaatgattatgaaggcccttaagtggcgt
ttaagtcccctgactattgtgtcctggctgaatgtatacatgcaggttgcatatctaaat
gacttacatgaagtgctactgccgcagtatccccagcaaatctttatacagattgcagag
ctgttggatctctgtgtcctggatgttgactgccttgaatttccttatggtatacttgct
gcttcggccttgtatcatttctcgtcatctgaattgatgcaaaaggtttcagggtatcag
tggtgcgacatagagaactgtgtcaagtggatggttccatttgccatggttataagggag
atggggagctcaaaactgaagcacttcaggggcgtcgctgatgaagatgcacacaacata
cagacccacagagacagcttggatttgctggacaaagcccgagcaaagaaagtcatgttg
tctgaacaaaatagggcttctcctctccccagtgggctcctcaccccgccacagagcggt
aagaagcagagcagcgggccggaaatggcgtga

DBGET integrated database retrieval system