KEGG   Pongo abelii (Sumatran orangutan): 100438416
Entry
100438416         CDS       T01416                                 

Gene name
CRTC2
Definition
(RefSeq) CREB-regulated transcription coactivator 2 isoform X1
  KO
K16333  CREB-regulated transcription coactivator 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04922  Glucagon signaling pathway
pon04931  Insulin resistance
pon05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100438416 (CRTC2)
   04152 AMPK signaling pathway
    100438416 (CRTC2)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    100438416 (CRTC2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100438416 (CRTC2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100438416 (CRTC2)
SSDB
Motif
Pfam: TORC_M TORC_C TORC_N
Other DBs
NCBI-GeneID: 100438416
NCBI-ProteinID: XP_024101365
Ensembl: ENSPPYG00000000794
LinkDB
Position
1
AA seq 698 aa
MATSGANGPGSATASASNPRKFSEKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLRLA
YTRSSHYGGSLPNVNQIGSGLAEFQSPLHSPLDSSRSTRHHGLVERVQRDPRRMVSPLRR
YPRHIDSSPYSPAYLSPPPESSWRRMMPWGNFPAEKGQLFRLPSALNRTSSDSALHTSVM
NPSPQDTYPGPTPPSILPSRRGGILDGEMDPKVFLFQVPAIEENLLDDKHLLKPWDAKKL
SSSSSRPRSCEVPGINIFPSPDQPANVPVLPPAMNTGGSLPDLTNLHFPPPLPTPLDPEE
TSYPSLSGGNSTSNLTHTMTHLGISRGMGLGPGCDAPGLHSPLSHPSLQSSLSNPNLQAS
LSSPQPQLQGSHSHPSLPASSLARHALPTTSLGHPSLSAPALSSSSSSSSTSSPVLGAPP
YPASTPGASPHHRRVPLSPLSLLAGPADARRSQQQLPKQFSPTMSPTLSSITQGVPLDTS
KLSIDQRLPPYPYSSPSLVLPTQPHTPKSLQQPGLPSQSCSVQSSVGQPPGRQSHYGTLY
PSGPSGHGQQSYHRPMSDFNLGNLEQFSMESPSTGLVLDPPGFSEGPGFLGGEGPMGGPQ
DPHTLNHQNLTHCSRHGSGPNIILTGDSSPGFSKEIAAALAGVPGFEVSAAGLELGLGLE
DELRMEPLGLEGLNMLSDPCALLPDPAVEDSFRSDRLQ
NT seq 2097 nt   +upstreamnt  +downstreamnt
atggcgacgtcgggggcgaacgggcctggctcggccacggcctcggcttccaatccgcgc
aaatttagtgagaagatcgcgttgcagaagcagcgtcaggccgaggagacggcggccttc
gaggaggtgatgatggacatcggctccacccggttacaggcccaaaaactgcgactggca
tacacaaggagctctcattatggtgggtctctgcccaatgttaaccagattggctctggc
ctggccgagttccagagccccctccactcacctttggattcatctcggagcactcggcac
catgggctggtggaacgggtgcagcgagatcctcgaagaatggtgtccccacttcgccga
tacccccgccacattgacagctctccctatagtcctgcctacttatctcctcccccagag
tctagctggcgaaggatgatgccctggggcaatttccctgcagagaagggacagttgttt
cgactaccatctgcacttaacaggacaagctctgactctgcccttcatacaagtgtgatg
aaccccagtccccaggatacctacccaggccccacacctcccagcatcctgcccagccga
cgtgggggtattctggatggtgaaatggaccccaaagtctttctctttcaagtacctgct
attgaggagaacttgctagatgacaagcatttgctgaagccctgggatgctaagaagcta
tcctcatcctcttcccgacctcggtcctgtgaagtccctggaattaacatctttccatct
cctgaccagcctgccaatgtgcctgtcctcccacctgccatgaacacggggggctcccta
cctgacctcaccaacctgcactttcccccaccactgcccacccccctggaccctgaagag
acaagctaccctagcctgagtgggggcaacagtacctccaatttgacccacaccatgact
cacctgggcatcagcaggggcatgggtctgggcccaggctgtgatgcaccaggacttcat
tcacctctcagccacccatccctgcagtcctccctaagcaatcccaacctccaggcttcc
ctgagcagtcctcagccccagcttcagggctcccacagccacccctctctgcctgcctcc
tccttggcccgccatgcactgcccaccacctccctgggccacccctcactcagtgctccg
gctctctcctcctcctcttcctcctcctccacttcatctcctgttttgggtgccccccct
taccctgcttctacccctggggcctccccccaccaccgccgtgtgcccctcagccccctg
agtttgctcgcgggcccagccgacgccagaaggtcccaacagcagctgcccaaacagttt
tcgccaacaatgtcacccaccttgtcttccatcactcagggcgtccccctggataccagt
aaactgtccattgaccagcggttgcccccatacccatacagctccccaagtctggttctg
cctacccagccacacaccccaaagtctctacagcagccagggctgccctctcagtcttgt
tcagtgcagtcctcagttgggcagcccccaggcaggcagtctcattatgggacactgtac
ccatctgggcccagtgggcacgggcaacagtcttaccaccggccaatgagtgacttcaac
ctggggaatctggagcagttcagcatggagagcccatcaaccggcctggtgctggatccc
cctggcttttctgaagggcctggatttttagggggtgaggggccaatgggtggcccccaa
gatccccacaccctcaaccaccagaacttgacccactgttcccgccatggctcagggcct
aacatcatcctcacaggggactcctctccaggtttctctaaggagattgcagcagccctg
gccggagtgcctggctttgaggtgtcagcagctggattggagctagggcttgggctagaa
gatgagctgcgcatggagccactgggcctggaagggctaaacatgctgagtgacccctgt
gccctgctgcctgatcctgctgtggaggattcattccgcagtgaccggctccaatga

DBGET integrated database retrieval system