KEGG   Pongo abelii (Sumatran orangutan): 100438667
Entry
100438667         CDS       T01416                                 

Gene name
TNFRSF1A
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 1A
  KO
K03158  tumor necrosis factor receptor superfamily member 1A
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04060  Cytokine-cytokine receptor interaction
pon04061  Viral protein interaction with cytokine and cytokine receptor
pon04064  NF-kappa B signaling pathway
pon04071  Sphingolipid signaling pathway
pon04150  mTOR signaling pathway
pon04210  Apoptosis
pon04215  Apoptosis - multiple species
pon04217  Necroptosis
pon04380  Osteoclast differentiation
pon04668  TNF signaling pathway
pon04920  Adipocytokine signaling pathway
pon04931  Insulin resistance
pon04932  Non-alcoholic fatty liver disease
pon05010  Alzheimer disease
pon05014  Amyotrophic lateral sclerosis
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
pon05142  Chagas disease
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100438667 (TNFRSF1A)
   04064 NF-kappa B signaling pathway
    100438667 (TNFRSF1A)
   04668 TNF signaling pathway
    100438667 (TNFRSF1A)
   04071 Sphingolipid signaling pathway
    100438667 (TNFRSF1A)
   04150 mTOR signaling pathway
    100438667 (TNFRSF1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100438667 (TNFRSF1A)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100438667 (TNFRSF1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100438667 (TNFRSF1A)
   04215 Apoptosis - multiple species
    100438667 (TNFRSF1A)
   04217 Necroptosis
    100438667 (TNFRSF1A)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100438667 (TNFRSF1A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100438667 (TNFRSF1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100438667 (TNFRSF1A)
   05014 Amyotrophic lateral sclerosis
    100438667 (TNFRSF1A)
   05022 Pathways of neurodegeneration - multiple diseases
    100438667 (TNFRSF1A)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100438667 (TNFRSF1A)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100438667 (TNFRSF1A)
   04931 Insulin resistance
    100438667 (TNFRSF1A)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100438667 (TNFRSF1A)
   05152 Tuberculosis
    100438667 (TNFRSF1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100438667 (TNFRSF1A)
   05170 Human immunodeficiency virus 1 infection
    100438667 (TNFRSF1A)
   05160 Hepatitis C
    100438667 (TNFRSF1A)
   05171 Coronavirus disease - COVID-19
    100438667 (TNFRSF1A)
   05164 Influenza A
    100438667 (TNFRSF1A)
   05168 Herpes simplex virus 1 infection
    100438667 (TNFRSF1A)
   05163 Human cytomegalovirus infection
    100438667 (TNFRSF1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100438667 (TNFRSF1A)
   05165 Human papillomavirus infection
    100438667 (TNFRSF1A)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100438667 (TNFRSF1A)
   05142 Chagas disease
    100438667 (TNFRSF1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100438667 (TNFRSF1A)
   04090 CD molecules [BR:pon04090]
    100438667 (TNFRSF1A)
Cytokine receptors [BR:pon04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100438667 (TNFRSF1A)
CD molecules [BR:pon04090]
 Proteins
  100438667 (TNFRSF1A)
SSDB
Motif
Pfam: TNFR_c6 Death
Other DBs
NCBI-GeneID: 100438667
NCBI-ProteinID: XP_002822854
Ensembl: ENSPPYG00000004183
LinkDB
Position
12
AA seq 455 aa
MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCT
KCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVD
RDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECV
SCSNCKKSLECTKLCLPQIENVKGTEDSGTTVLLPLVIFFGLCLLSLLFIGLMYRYQRWK
SKLYSIVCGKSTPEKEGELEGTTTKPLAPTPSFSPTPGFTPTLGFSPMPSSTFTSSSTYT
PGDCPNFAAPRREVAPPYQGADPILVTALASDPIPTPFQKWEDSAHKPQSLDTDDPATLY
AVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQYSMLAAWRRRTPRREATLEL
LGRVLRDMDLLGCLEDIEEALCGPAALPPAPGLLR
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgggcctctccaccgtgcctgacctgctgctgccactggtgctcctggagctgttggtg
ggaatatacccctcaggggttattggactggtccctcacctcggggacagggagaagaga
gatagtgtgtgtccccaaggaaaatatatccaccctcaaaataattccatttgctgtacc
aagtgccacaaaggaacctacttgtacaatgactgtccaggcccggggcaggatacggac
tgcagggagtgtgagagcggctccttcaccgcttcagagaaccacctcagacactgcctc
agctgctccaaatgccgaaaggaaatgggccaggtggagatctcttcttgcacagtggac
cgggacaccgtgtgtggctgcaggaagaaccagtaccggcattattggagtgaaaacctt
ttccagtgcttcaattgcagcctctgcctcaatgggactgtgcacctctcctgccaggag
aaacagaacaccgtgtgcacctgccatgcagggttctttctaagagaaaatgagtgtgtc
tcctgtagtaactgtaagaaaagcctggagtgcacaaagttgtgcctaccccagattgag
aatgttaagggcactgaggactcaggcaccacagtgctgttgcccctggtcatcttcttt
ggtctttgccttttatctctcctcttcattggtttaatgtatcgttaccaacggtggaag
tccaagctctactccattgtttgtgggaaatcgacacctgaaaaagagggggagcttgaa
ggaactactactaagcccctggccccaaccccaagcttcagtcccactccaggcttcacc
cccaccctgggcttcagtcccatgcccagttccaccttcacctccagctccacctatacc
cccggtgactgtcccaacttcgcggctccccgcagagaggtggcaccaccctaccagggg
gctgaccccatccttgtgacagccctcgcctccgaccccatccccaccccctttcagaag
tgggaggacagcgcccacaagccacagagcctagacacggatgaccccgcgacgctgtac
gccgtggtggagaacgtgcccccgttgcgctggaaggaattcgtgcggcgcctagggctg
agcgaccacgagatcgatcggctggagctgcagaacgggcgctgcctgcgggaggcgcaa
tacagcatgctggcggcctggaggcggcgcacgccgcggcgcgaggccacgctggagctg
ctgggacgcgtgctccgcgacatggacctgctgggctgcctggaggacatcgaggaggcg
ctttgcggccccgccgccctcccgcccgcgcccggtcttctcagatga

DBGET integrated database retrieval system