KEGG   Pongo abelii (Sumatran orangutan): 100438713
Entry
100438713         CDS       T01416                                 

Gene name
STK4
Definition
(RefSeq) serine/threonine-protein kinase 4
  KO
K04411  serine/threonine kinase 4
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04068  FoxO signaling pathway
pon05200  Pathways in cancer
pon05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100438713 (STK4)
   04014 Ras signaling pathway
    100438713 (STK4)
   04068 FoxO signaling pathway
    100438713 (STK4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100438713 (STK4)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    100438713 (STK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100438713 (STK4)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: STE group
  STE20 family
   100438713 (STK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Mst1_SARAH Pkinase_fungal Abi_2 Haspin_kinase DUF4611
Other DBs
NCBI-GeneID: 100438713
NCBI-ProteinID: XP_009231903
Ensembl: ENSPPYG00000011045
LinkDB
Position
20
AA seq 487 aa
METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIKQ
VPVESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKT
LTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAK
RNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNP
PPTFRKPELWSDNFTDFVKQCLVKSPEQRATATQLLQHPFVKSAKGVSILRDLINEAMDV
KLKRQESQQREVDQDDEENSEEDEMDSGTMVRAVGEEMGTVRVASTMTDGANTMIEHDDT
LPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPAPLK
NSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAK
KRRQQNF
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggagacggtacagctgaggaacccgccgcgccggcagctgaaaaagttggatgaagat
agtttaaccaaacaaccagaagaagtatttgatgtcttagagaaacttggagaagggtcc
tatggcagtgtatacaaagctattcataaagagaccggtcagattgttgctattaagcaa
gttcctgtggaatcagacctccaggagataatcaaagaaatctctataatgcagcaatgt
gacagccctcatgtagtcaaatattatggcagttattttaagaacacagacttatggatc
gttatggagtactgtggggctggttctgtatctgatatcattcgattacgaaataaaacg
ttaacagaagatgaaatagctacaatattacaatcaactcttaagggacttgaatacctt
cattttatgagaaaaatacaccgagatatcaaagcaggaaatattttgctaaatacagaa
ggacatgcaaaacttgcagattttggggtagcaggtcaacttacagataccatggccaag
cggaatacagtgataggaacaccattttggatggctccagaagtgattcaggaaattgga
tacaactgtgtagcagatatctggtccctgggaataactgccatagaaatggctgaagga
aagcccccttatgccgatatccatccaatgagggcaatcttcatgattcctacaaatcct
cctcccacattccgaaaaccagagctatggtcagataactttacagattttgtgaaacag
tgtcttgtaaagagccctgagcagagagccacagccactcagctcctgcagcacccattt
gtcaagagtgccaaaggagtgtcaatactgcgagacttaattaatgaagccatggatgtg
aaactgaaacgccaggaatcccagcagcgggaagtggaccaggacgatgaagaaaactca
gaagaggatgaaatggattctggcacaatggttcgagcagtgggtgaagagatgggcact
gtccgagtagccagcaccatgactgatggagccaatactatgattgagcatgatgacacg
ttgccatcacagctgggcaccatggtgatcaatgcagaggatgaggaagaggaaggaact
atgaaaagaagggatgagaccatgcaacctgcaaaaccatcttttcttgaatattttgaa
caaaaagaaaaggaaaaccagatcaacagctttggcaagagtgtacctgctccactgaaa
aattcttcagattggaaaataccacaggatggagactacgagtttcttaagagttggaca
gtggaggaccttcagaagaggctcttggccctggaccccatgatggagcaggagattgaa
gagatccggcagaagtaccagtccaagcggcagcccatcctggatgccattgaggctaag
aagagacggcaacaaaacttctga

DBGET integrated database retrieval system