KEGG   Pongo abelii (Sumatran orangutan): 100439439
Entry
100439439         CDS       T01416                                 

Gene name
RARB
Definition
(RefSeq) retinoic acid receptor beta isoform X3
  KO
K08528  retinoic acid receptor beta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05200  Pathways in cancer
pon05222  Small cell lung cancer
pon05223  Non-small cell lung cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100439439 (RARB)
  09162 Cancer: specific types
   05226 Gastric cancer
    100439439 (RARB)
   05222 Small cell lung cancer
    100439439 (RARB)
   05223 Non-small cell lung cancer
    100439439 (RARB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100439439 (RARB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:pon03310]
    100439439 (RARB)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    100439439 (RARB)
Nuclear receptors [BR:pon03310]
 1. Thyroid hormone like
  1B. Retinoic acid receptor (RAR)
   100439439 (RARB)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 100439439
NCBI-ProteinID: XP_002814046
Ensembl: ENSPPYG00000014062
UniProt: A0A2J8WZ19
LinkDB
Position
3
AA seq 448 aa
MFDCMDVLSVSPGQILDFYTASPSSCMLQEKALKACFSGLTQTEWQHRHTAQSIETQSTS
SEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRD
KNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEMTAELDDL
TEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLP
GFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTD
LVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRR
PSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSS
SGNTAEHSPSISPSSVENSGVSQSPLVQ
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgtttgactgtatggatgttctgtcagtgagtcctgggcaaatcctggatttctacact
gcgagtccgtcttcctgcatgctccaggagaaagctctcaaagcatgcttcagtggattg
acccaaaccgaatggcagcatcggcacactgctcaatcgattgaaacacagagcaccagc
tctgaggaactcgtcccaagccccccatctccacttcctccccctcgagtatacaaaccc
tgcttcgtctgccaggacaaatcatcagggtaccactatggggtcagcgcctgtgaggga
tgtaagggctttttccgcagaagtattcagaagaatatgatttacacttgtcaccgagat
aagaactgtgttattaataaagtcaccaggaatcgatgccaatactgtcgactccagaag
tgctttgaagtgggaatgtccaaagaatctgtcaggaatgacaggaacaagaaaaagaag
gagacttcgaagcaagaatgcacagagagctatgaaatgacagctgagttggacgatctc
acagagaagatccgaaaagctcaccaggaaactttcccttcgctctgccagctgggtaaa
tacaccacgaattccagtgctgaccatcgagtccgactggacctgggcctctgggacaaa
ttcagtgaactggccaccaagtgcattattaagatcgtggagtttgctaaacgtctgcct
ggtttcactggcttgaccatcgcagaccaaattaccctgctgaaggccgcctgcctggac
atcctgattcttagaatttgcaccaggtataccccagaacaagacaccatgactttctca
gacggccttaccctaaatcgaactcagatgcacaatgctggatttggtcctctgactgac
cttgtgttcacctttgccaaccagctcctgcctttggaaatggatgacacagaaacaggc
cttctcagtgccatctgcttaatctgtggagaccgccaggaccttgaggaaccgacaaaa
gtagataagctacaagaaccattgctggaagcactaaaaatttatatcagaaaaagacga
cccagcaagcctcacatgtttccaaagatcttaatgaaaatcacagatctccgtagcatc
agtgctaaaggtgcagagcgtgtaattaccttgaaaatggaaattcctggatcaatgcca
cctctcattcaagaaatgctggagaattctgaaggacatgaacccttgaccccaagttca
agtgggaacacagcagagcacagtcctagcatctcacccagctcagtggaaaacagtggg
gtcagtcagtcaccactcgtgcaataa

DBGET integrated database retrieval system