KEGG   Pongo abelii (Sumatran orangutan): 100439533
Entry
100439533         CDS       T01416                                 

Gene name
BRCA1
Definition
(RefSeq) breast cancer type 1 susceptibility protein isoform X5
  KO
K10605  breast cancer type 1 susceptibility protein [EC:2.3.2.27]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01524  Platinum drug resistance
pon03440  Homologous recombination
pon03460  Fanconi anemia pathway
pon04120  Ubiquitin mediated proteolysis
pon04151  PI3K-Akt signaling pathway
pon05206  MicroRNAs in cancer
pon05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100439533 (BRCA1)
  09124 Replication and repair
   03440 Homologous recombination
    100439533 (BRCA1)
   03460 Fanconi anemia pathway
    100439533 (BRCA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100439533 (BRCA1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100439533 (BRCA1)
  09162 Cancer: specific types
   05224 Breast cancer
    100439533 (BRCA1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100439533 (BRCA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pon01009]
    100439533 (BRCA1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pon04121]
    100439533 (BRCA1)
   03036 Chromosome and associated proteins [BR:pon03036]
    100439533 (BRCA1)
   03400 DNA repair and recombination proteins [BR:pon03400]
    100439533 (BRCA1)
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100439533 (BRCA1)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100439533 (BRCA1)
Ubiquitin system [BR:pon04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    100439533 (BRCA1)
  Multi subunit Ring-finger type E3
   BRCC complex
    100439533 (BRCA1)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     100439533 (BRCA1)
DNA repair and recombination proteins [BR:pon03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-core complex
     100439533 (BRCA1)
    BRCA1-A complex
     100439533 (BRCA1)
    BRCA1-B complex
     100439533 (BRCA1)
    BRCA1-C complex
     100439533 (BRCA1)
    BRCA complex
     100439533 (BRCA1)
   FA (Fanconi anemia) pathway
    Downstream FA components
     100439533 (BRCA1)
SSDB
Motif
Pfam: BRCT_assoc BRCT BRCT_2
Other DBs
NCBI-GeneID: 100439533
NCBI-ProteinID: XP_002827529
Ensembl: ENSPPYG00000008363
LinkDB
Position
17
AA seq 1816 aa
MLKLLNQKKGPSQCPLCKNDITKRSLQESTRFSQLVEELLKIICAFQLDTGLQYANSYNF
AKKENNSPEHLKDEVSIIQSMGYRNRAKRLLQSEPENPSLQETSPSVQLSNLGTVRTLRT
KQRIQPQKKSVYIELGSDSSEDTVNKATYCSVGDQELLQITPQGTSDEISLDSAKKAACE
FSETDVTNTEHHQPSNNDLNTTEKRATERHPEKYQGSSVSNLHVEPCGTNTHASSLQHEN
SSLLLTKDRMNVEKAEFCNKSKQPGLARSQHNRWAGSKETCNDRQTPSTEKKVDLNADPL
CERKEWNKQKLPCSENPRDTEDVPWITLNSSIQKVNEWFSRSDELLGSDDSHDGRSESNA
KVADVLDVLNEVDEYSGSSEKIDLLASDPHEALICKSERVHSKSVESNIEDKIFGKTYRR
KASLPNLSHVTENLIIGAFVTEPQIIQERPLTNKLKRKRRATSGLHPEDFIKKADLAVQK
TPEMINQGTNQMEQNGQVMNITNSGHENKTKGDSIQNEKNPNPIESLEKESAFKTKAEPI
SSSISNMELELNIHNSKAPKKNRLRRKSSTRHIHALELVVSRNLSPPNCTELQIDSCSSS
EEIKKKKYNQMPVRHSRNLQLMEDKEPATGAKKSNKPNEQTSKRHDSDTFPELKLTNAPG
SFTNCSNTSELKEFVNPSLPREEKEEKLGTVKVSNNAKDPKDLMLSGGRVLQTERSVESS
SISLVPGTDYGTQESISLLEVSTLGKAKTEPNKCVSQCAAFENPKELIHGCFKDTRNDTE
GFKYPLGHEVNHSQETSIEMEESELDTQYLQNTFKVSKRQSFALFSNPGNPEEECATFSA
HSRSLKKQSPKVTFECEQKEENQGKNESNIKPVQTANITAGFPVVCQKDKPVDYAKCSIK
GGSRFCLSSQFRGNETGLITPNKHGLSQNPYHIPPLFPIKSFVKTKCKKNLLEENSEEHS
MSPEREMGNENIPSTVSIISRNNIRENVFKEASSSNINEVGSSTNEVGSSINEVGSSDEN
IQAELGRSRGPKLNAMLRLGVLQPEVYKQSFPGSNGKHPEIKKQEYEEVLQTVNTDFSPC
LISDNLEQPMRSSHASQVCSETPNDLLDDGEIKEDTSFAENDIKESSAVFSKSVQRGELS
RSPSPFTHTHLAQGYRRGAKKLESSEENLSSEDEELPCFQHLLFGKVSNIPSQSTRHSTV
ATECLSKNTEENLLSLKNSLNDYSNQVILVKASQEHHLSEETKCSASLFSSQCSELEDLT
ANTNTQDRFFIGSSKQMRHQSESQGVGLSDKELVSDDEERGTDLEENNQEEQGVDSNLGE
AASGYESETSVSEDCSGLSSQSDILTTQQRDTMQDNLIKLQQEMAELEAVLEQHGSQPSN
SYPSIISDSSALEDLRNPEQSTSEKAVLTSQKSSEYPISQNPEGLSADKFEVSADSSTNK
NKEPGVERSSPSKCPSLDDRWYMHSCSGSLQNGNYPSQEELIKVVDVEKQQLEESGPHDL
TEPSYLPRQDLEGTPYLESGISLFSDDPESDPSEDRAPESAHVGSIPSSTSALKVPQLKV
AESAQSPAAAQTTNTAGYNAMEESVSREKPELTASTERVNKRMSMVVSGLTPEEFMLVYK
FARKHHITLTNLITEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERK
MLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWIVQLC
GASVVKELSSFTLGTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLDSVALYQC
QELDTYLIPQIPHSHY
NT seq 5451 nt   +upstreamnt  +downstreamnt
atgctgaaacttctcaaccagaagaaagggccttcacagtgtcctttatgtaagaatgat
ataaccaaaaggagcctacaagaaagtacgagatttagtcaacttgtagaagagctattg
aaaatcatttgtgcttttcagcttgacacaggtttgcagtatgcaaacagttataatttt
gcaaaaaaggaaaataactctcctgaacatctaaaagatgaagtttctatcatccaaagt
atgggctacagaaatcgtgccaaaagacttctacagagtgaacccgaaaatccttccttg
caggaaaccagtcccagtgtccaactctctaaccttggaactgtgagaactctgaggaca
aagcagcggatacaacctcaaaagaagtctgtttacattgaattgggatctgattcttct
gaagatacggttaataaggcaacttattgcagtgtgggagatcaagaattgctacaaatc
acccctcaaggaaccagcgatgaaatcagtttggattctgcaaaaaaggctgcttgtgaa
ttttctgagacagatgtaacaaatactgaacatcatcaacccagtaataacgatttgaac
accactgagaagcgtgcaactgagaggcatccagaaaagtatcagggtagttctgtttca
aacttgcatgtggagccatgtggcacaaatactcatgccagctcattacagcatgagaac
agcagtttattactcactaaagacagaatgaatgtagaaaaggctgaattctgtaataaa
agcaaacagcctggcttagcaaggagccaacataacagatgggctggaagtaaggaaaca
tgtaatgataggcagactcccagcacagaaaaaaaggtagacctgaatgctgatcccctg
tgtgagagaaaagaatggaataagcagaaactgccatgctcagagaatcctagagatact
gaagatgttccttggataacactaaatagcagcattcagaaagttaatgagtggttttcc
agaagtgacgaactgttaggttctgatgactcacatgatgggaggtctgaatcaaatgcc
aaagtagcggatgtattggacgttctaaatgaggtagatgaatattctggttcttcagag
aaaatagacttactggccagtgatcctcatgaggctttaatttgtaaaagtgaaagagtt
cactccaaatcagtagagagtaatattgaagacaaaatatttgggaaaacctatcggagg
aaggcaagcctccccaacttaagccatgtaactgaaaatctaattataggagcatttgtt
actgagccacagataatacaagagcgtcccctcacaaataaattaaagcgtaaaaggaga
gctacatcaggccttcatcctgaggattttatcaagaaagcagatttggcagttcaaaag
actcctgaaatgataaatcagggaactaaccaaatggagcagaatggtcaagtgatgaat
attactaatagtggtcatgagaataaaacaaaaggtgattctattcagaatgagaaaaat
cctaacccaatagaatcactcgaaaaagaatctgctttcaaaacaaaagctgaacctata
agcagcagtataagcaatatggaactcgaattaaatatccataattcaaaagcacctaaa
aagaataggctgaggaggaagtcttctaccaggcatattcatgcgcttgaactagtagtc
agtagaaatctaagcccacctaattgtactgaattgcaaattgatagttgttctagcagt
gaagagataaagaaaaaaaaatacaaccaaatgccagtcaggcacagcagaaacctacaa
ctcatggaagataaagaacctgcaactggagccaagaagagtaacaagccaaatgaacag
acaagtaaaagacatgacagcgatactttcccagagctgaagttaacaaatgcacctggt
tcttttactaactgttcaaataccagtgagcttaaagaatttgtcaatcctagccttcca
agagaagaaaaagaagagaaactaggaacagttaaagtgtctaataatgccaaagacccc
aaagatctcatgttaagtggaggaagggttttgcaaactgaaagatctgtagagagtagc
agtatttcattggtacctggtactgattatggcactcaggaaagtatctcgttactggaa
gttagcactctagggaaggcaaaaacagaaccaaataaatgtgtgagtcagtgtgcagca
tttgaaaaccccaaggaactaattcatggttgtttcaaagatactagaaatgacacagaa
gggtttaagtatccattgggacatgaagttaaccacagtcaggaaacaagcatagaaatg
gaagaaagtgaacttgatactcagtatttgcagaatacattcaaggtttcaaagcgccag
tcatttgctctgttttcaaatccaggaaatccagaagaggaatgtgcaacattctctgcc
cactctaggtccttaaagaaacaaagtccaaaagtcacttttgaatgtgaacaaaaggaa
gaaaatcaaggaaagaatgagtctaatatcaagcctgtacagacagctaatatcactgca
ggctttcctgtggtttgtcagaaagataagccagttgattatgccaaatgtagtatcaaa
ggaggctctaggttttgtctatcatctcagttcagaggcaacgaaactggactcattact
ccaaataaacatggactttcacaaaacccatatcatataccaccactttttcccatcaag
tcatttgttaaaactaaatgtaagaaaaacctgctagaggaaaactctgaggaacattca
atgtcacctgaaagagaaatgggaaacgagaacattccaagtacagtgagcataattagc
cgtaataacattagagaaaatgtttttaaagaagccagctcaagcaatattaatgaagta
ggttccagtactaatgaagtgggctccagtattaatgaagtaggttccagtgatgaaaac
attcaagcagaactaggtagaagcagagggccaaaattgaatgctatgcttagattaggg
gttttgcaacctgaggtctataaacaaagttttcctggaagtaatggtaagcatcctgaa
ataaaaaagcaagaatatgaagaagtacttcagactgttaatacagacttctctccatgt
ctgatttcagataacctagaacagcctatgagaagtagtcatgcatctcaggtttgttct
gagacacctaatgacctgttagatgatggtgaaataaaggaagatactagttttgctgaa
aatgacattaaggaaagttctgctgtttttagcaaaagcgtccagagaggagagcttagc
aggagtcctagccctttcacccatacacatttggctcagggttaccgaagaggggccaag
aaattagagtcctcagaagagaacttatctagtgaggatgaagagcttccctgcttccaa
cacttgttatttggtaaagtaagcaatataccttctcagtctactaggcatagcaccgtt
gctaccgagtgtctgtctaagaacacagaggagaatttattatcattgaagaatagctta
aatgactacagtaaccaggtaatattggtaaaggcatcccaggaacatcaccttagtgag
gaaacaaaatgttctgctagcttgttttcttcacagtgcagtgaactggaagacttgact
gcaaatacaaacacccaggatcgtttcttcattggttcttctaaacaaatgaggcatcag
tctgaaagccagggagttggtctgagtgacaaggaattggtttcagatgatgaagaaaga
ggaacggacttggaagaaaataatcaagaagagcaaggcgtggattcaaacttaggtgaa
gcagcatctgggtatgagagtgaaacaagcgtctctgaagactgctcagggctatcctct
cagagtgacattttaaccactcagcagagggataccatgcaagataacctgataaagctc
cagcaggaaatggctgaactagaagctgtgttagaacagcatgggagccagccttctaac
agctacccttccatcataagtgactcttctgcccttgaggacctgcgaaatccagaacaa
agcacatcagaaaaagcagtattaacttcacagaaaagtagtgaataccctataagccag
aatccagaaggcctttctgctgacaagtttgaggtgtctgcagatagttcaaccaataaa
aataaagaaccaggagtggaaaggtcatccccttctaaatgcccgtcattagatgatagg
tggtacatgcacagttgctctgggagtcttcagaatggaaactacccatctcaagaggag
ctcattaaggttgttgatgtggagaagcaacagctggaagagtctgggccacacgatttg
acggaaccatcttacttgccaaggcaagatctagagggaaccccttacctggaatctgga
atcagcctcttctctgatgaccctgaatctgatccttctgaagacagagccccagagtca
gctcatgttggcagcataccatcttcaacctctgcattgaaagtaccccaattgaaagtt
gcagaatctgcccagagtccagctgctgctcagactactaatactgctgggtataatgcg
atggaagaaagtgtgagcagggaaaagccagaattgacagcttcaacagaaagggtcaac
aaaagaatgtccatggtggtgtctggcctgaccccagaagaatttatgctcgtgtacaag
tttgccagaaaacaccacatcactttaactaatctaattactgaagagactactcatgtt
gttatgaaaacagatgctgagtttgtgtgtgaacggacactgaaatattttctaggaatt
gcgggaggaaaatgggtagttagctatttctgggtgacccagtctattaaagaaagaaaa
atgctgaatgagcatgattttgaagtcagaggagatgtggtcaatggaagaaaccaccaa
ggtccaaagcgagcaagagaatctcaggacagaaagatcttcagggggctagaaatctgt
tgctatgggcccttcaccaacatgcccacagatcaactggaatggatagtacagctgtgt
ggtgcttctgtggtgaaggagctttcatcattcacccttggcacaggtgtccacccaatt
gtggttgtgcagccagatgcctggacagaggacaatggcttccatgcaattgggcagatg
tgtgaggcacctgtggtgacccgagagtgggtgttggacagtgtagcactctaccagtgc
caggagctggacacctacctgataccccagatcccccacagccactactga

DBGET integrated database retrieval system