KEGG   Pongo abelii (Sumatran orangutan): 100439548
Entry
100439548         CDS       T01416                                 

Gene name
CDC37
Definition
(RefSeq) hsp90 co-chaperone Cdc37
  KO
K09554  cell division cycle protein 37
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100439548 (CDC37)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pon03110]
    100439548 (CDC37)
   03029 Mitochondrial biogenesis [BR:pon03029]
    100439548 (CDC37)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100439548 (CDC37)
Chaperones and folding catalysts [BR:pon03110]
 Other chaperones and cochaperones
  Cdc37 / p50
   100439548 (CDC37)
Mitochondrial biogenesis [BR:pon03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    100439548 (CDC37)
Glycosaminoglycan binding proteins [BR:pon00536]
 Hyaluronan
  Intracellular proteins
   100439548 (CDC37)
SSDB
Motif
Pfam: CDC37_M CDC37_C CDC37_N T3SSipB Med4 Syntaxin-6_N Atg14
Other DBs
NCBI-GeneID: 100439548
NCBI-ProteinID: XP_024092632
Ensembl: ENSPPYG00000009551
LinkDB
Position
19
AA seq 378 aa
MVDYSVWDHIEVSDDEDETHPNIDTASLFRWRHQARVERMEQFQKEKEELDRGCRECKRK
VAECQRKLKELEVAEGGKAELERLQAEAQQLRKEERSWEQKLEEMRKKEKSMPWNVDTLS
KDGFSKSMVNTKPEKTEEDSEEVREQKHKTFVEKYEKQIKHFGMLRRWDDSQKYLSDNVH
LVCEETANYLVIWCIDLEVEEKCALMEQVAHQTIVMQFILELAKSLKVDPRACFRQFFTK
IKTADRQYMEGFNDELEAFKERVRGRAKLRIEKAMKEYEEEERKKRLGPGGLDPIEVYES
LPEELQKCFDVKDVQMLQDAISKMDPTDAKYHMQRCIDSGLWVPNSKASEAKEGEEAGPG
DPLLESVPKTGDEKDVSV
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggtggactacagcgtgtgggaccacattgaggtgtctgatgatgaagacgagacgcac
cccaacatcgacacggccagcctcttccgctggcggcatcaggcccgggtggagcgcatg
gagcagttccagaaggagaaggaggaactggacaggggctgccgcgagtgcaagcgcaag
gtggccgagtgccagaggaagctgaaggagctggaggtcgccgagggcggcaaggcagag
ctggagcggctgcaggctgaggcacagcagctgcgcaaggaggagcggagctgggagcag
aagctggaggagatgcgcaagaaggagaagagcatgccctggaacgtggacacgctcagc
aaagacggcttcagcaagagcatggtaaataccaagcccgagaagacggaggaggactca
gaggaggtgagggagcagaaacacaagaccttcgtggaaaaatacgagaaacagatcaag
cactttggcatgctccgccgctgggatgacagccaaaagtacctgtcagacaacgtccac
ctggtgtgcgaggagacggccaattacctggtcatttggtgcattgacctagaggtggag
gagaaatgtgcactcatggagcaggtggcccaccagacaatcgtcatgcaatttatccta
gagctggccaagagcctgaaggtggacccccgggcctgcttccggcagttcttcactaag
attaagacagccgatcgccagtacatggagggcttcaacgatgagctggaagccttcaag
gagcgtgtgcggggccgcgccaagctgcgcatcgagaaggccatgaaagagtacgaggag
gaggagcgcaagaagcggctcggccctggcggcctggaccccatcgaggtctacgagtcc
ctccccgaggaactccagaagtgcttcgatgtgaaggacgtgcagatgctgcaagacgcc
atcagcaagatggaccccaccgacgcaaagtaccacatgcagcgctgcattgactctggc
ctctgggtccccaactctaaggccagcgaggccaaggagggagaggaggcaggtcctggg
gacccactactggaatctgttcccaagacgggcgatgagaaggatgtcagtgtgtga

DBGET integrated database retrieval system