KEGG   Pongo abelii (Sumatran orangutan): 100439813
Entry
100439813         CDS       T01416                                 

Gene name
PLD1
Definition
(RefSeq) phospholipase D1 isoform X1
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00564  Glycerophospholipid metabolism
pon00565  Ether lipid metabolism
pon01100  Metabolic pathways
pon04014  Ras signaling pathway
pon04024  cAMP signaling pathway
pon04071  Sphingolipid signaling pathway
pon04072  Phospholipase D signaling pathway
pon04144  Endocytosis
pon04666  Fc gamma R-mediated phagocytosis
pon04724  Glutamatergic synapse
pon04912  GnRH signaling pathway
pon04928  Parathyroid hormone synthesis, secretion and action
pon05200  Pathways in cancer
pon05212  Pancreatic cancer
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100439813 (PLD1)
   00565 Ether lipid metabolism
    100439813 (PLD1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100439813 (PLD1)
   04072 Phospholipase D signaling pathway
    100439813 (PLD1)
   04071 Sphingolipid signaling pathway
    100439813 (PLD1)
   04024 cAMP signaling pathway
    100439813 (PLD1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100439813 (PLD1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100439813 (PLD1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100439813 (PLD1)
   04928 Parathyroid hormone synthesis, secretion and action
    100439813 (PLD1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100439813 (PLD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100439813 (PLD1)
   05231 Choline metabolism in cancer
    100439813 (PLD1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100439813 (PLD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100439813 (PLD1)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     100439813 (PLD1)
Membrane trafficking [BR:pon04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100439813 (PLD1)
 Endosome - Golgi transport
  Others
   Others
    100439813 (PLD1)
SSDB
Motif
Pfam: PX PLDc_2 PLDc PH
Other DBs
NCBI-GeneID: 100439813
NCBI-ProteinID: XP_002814331
Ensembl: ENSPPYG00000014298
UniProt: A0A663DIY6 H2PC00
LinkDB
Position
3
AA seq 1074 aa
MSLKNERRVNTSALQKIAADMSNIIENLDTRELHFEGEEVEYDMSPSDPKIQEVYIPFSA
VYNTQGFKEPNIQMYLSGCPIKAQVLEVERFTSTTRVPSINLYTIELTHGEFKWQVKRKF
KHFQEFHRELLKYKAFIRIPIPTRRHTFRRQNVREEPREMPSLPRSSENMIREEQSLGRR
KQLEDYLTKILKMPMYRNYHATTEFLDISQLSFIHDLGPKGIEGMIMKRSGGHRIPGLNC
CGQGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDKEFKIKVGKKETETKYGIRID
NLSRTLILKCNSYRHARWWGGAIEEFIQKHGTNFLKDHRFGSYAAIQENALAKWYVNAKG
YFEDVANAMEEASEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAQQGVRIFIMLY
KEVELALGINSEYTKKTLMRLHPNIKVMRHPDHVSSTVYLWAHHEKLVIIDQSVAFAGGI
DLAYGRWDDNEHRLTDVGSVKRVTSGPSLGSLPPAATESMESLRLQDKNEPDQNPPIQKS
VDDVDSKLKGIGKPRKFSKFSLYKQLHRHHLHNADSISSIDSTSSYFNHYRSHHNLIHGL
KPHFKLYRPSSESEQGLTRPNADTGSIRSLQTGVGELHGETRFWHGKDYCNFVFKDWVQL
DKPFADFIDRYSMPRMPWHDIASAVHGKAARDVARHFIQRWNFTKIMKSKYRSLSYPFLL
PKSQTTAHELRYQVPGSVHANVQLLRSAADWSAGIKYHEESIHAAYVYVIENSRHYIYIE
NQFFISCADDKVVFNKIGDAIAQRILKAHRENQKYRVYVVIPLLPGFEGDISTGGGNALQ
AIMHFNYRTMCRGENSILGQLKAELGNQWINYISFCGLRTHAELEGNLVTELIYVHSKLL
IADDNTVIIGSANINDRSMLGKRDSEMAVIVQDTETVPSVMDGEEYQAGRFAQGLRLQCF
RVVLGYLNDPSEDIQDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFI
NKPVLAKEDPIRAEEELKKIRGFLVQFPFNFLSEESLLPSVGTKEAIVPMEVWT
NT seq 3225 nt   +upstreamnt  +downstreamnt
atgtcactgaaaaacgagagacgggtaaatacctctgcactgcagaaaattgctgctgac
atgagtaatatcatagaaaatctggacacgcgggaactccactttgagggagaggaggta
gaatacgacatgtctcccagcgatcccaagatacaggaagtgtatatccctttctctgct
gtttataacactcaaggatttaaggagcctaatatacagatgtatctctctggctgtcca
ataaaagcacaagttctggaagtggaacgcttcacatctacaacaagggtaccaagtatt
aatctttacactattgaattaacacatggggaatttaaatggcaagttaagaggaaattc
aagcattttcaagaatttcacagagagctgctcaagtacaaagcctttatccgaatcccc
attcccactagaagacacacatttaggaggcaaaacgtcagagaggagcctcgagagatg
cccagtttgccccgttcatctgaaaacatgataagagaagaacaatcccttggtagaaga
aaacaactggaagattacttgacaaagatactaaaaatgcccatgtatagaaactatcat
gccacaacagagtttcttgatataagccagctgtctttcatccatgatttgggaccaaag
ggcatagaaggtatgataatgaaaagatctggaggacacagaataccaggcttgaattgc
tgtggtcagggaagagcctgctacagatggtcaaaaagatggttaatagtgaaagattcc
tttttattgtatatgaaaccagacagcggtgccattgccttcgtcctgctggtagacaaa
gaattcaaaattaaggtggggaagaaggagacagaaacgaaatatggaatccgaattgat
aatctttcaaggacacttattttaaaatgcaacagctatagacatgctcggtggtgggga
ggggctatagaagaattcatccagaaacatggcaccaactttctcaaagatcatcgattt
gggtcatatgctgctatccaagagaatgctttagctaaatggtatgttaatgccaaagga
tattttgaagatgtggcaaatgcaatggaagaggcaagtgaagagatttttatcacagat
tggtggctgagtccagaaatcttcctgaaacgcccggtggttgagggaaatcgttggagg
ttggactgcattcttaaacgaaaagcacaacaaggggtgaggatcttcataatgctctac
aaagaggtggaactcgctcttggcatcaatagtgaatacaccaagaagactttgatgcgt
ctacatcccaacataaaggtgatgagacacccggatcatgtgtcatccaccgtctatttg
tgggctcaccatgagaagctcgtcatcattgaccaatcggtggcctttgcgggagggatt
gacctggcctatggaaggtgggacgacaatgagcacagactcacagacgtgggcagtgtg
aagcgggtcacttcaggaccatctctgggttccctcccacctgccgcaacagagtctatg
gaatccttaagactccaagataaaaatgagcctgatcaaaacccacccatccagaagagt
gttgacgatgtggattcaaaactgaaaggaataggaaagccaagaaagttctccaaattt
agtctttacaagcagctccacaggcaccacctgcacaacgcggatagcatcagcagcatt
gacagcacctccagttattttaatcactatagaagtcatcacaatttaatccatggttta
aaaccccacttcaaactctatcgcccgtccagtgagtctgagcaaggactcactagacct
aatgctgataccgggtccatccgcagtttacagacaggtgtgggagagctgcatggggaa
accagattctggcatggaaaggactactgcaatttcgtcttcaaagactgggttcaactt
gataaaccttttgctgatttcattgacaggtactccatgccccggatgccctggcatgac
attgcctctgcagtccacgggaaggcggctcgtgatgtggcacgtcacttcatccagcgc
tggaatttcacgaaaattatgaaatcaaaatatcggtctctttcttatccttttctgctt
ccaaagtctcaaacaacagcccatgagttgagatatcaagtgcctgggtctgtccatgct
aacgtacagttgctccgctctgctgctgattggtctgctggtataaagtaccatgaagag
tccatccatgccgcttacgtctatgtgatagagaacagcaggcactatatctatatcgaa
aaccagtttttcataagctgtgctgatgacaaagttgtgttcaacaagataggcgatgcc
attgcccagaggattctgaaagctcacagggaaaaccagaaataccgggtatatgtcgtg
ataccgcttctgccagggttcgaaggagacatttcaaccggcggaggaaatgctctacag
gcaatcatgcacttcaactacagaaccatgtgcagaggagaaaattccatccttggacag
ttaaaagcagagcttggtaatcagtggataaattacatatcattctgtggtcttagaaca
catgcagagcttgaaggaaacctagtcactgagcttatctatgtccacagcaagttgtta
attgctgatgataacactgttattattggctctgccaacataaatgaccgcagcatgctg
ggaaagcgtgacagtgaaatggctgtcatcgtgcaagatacagagactgttccttcagta
atggatggagaagagtaccaagctggccggtttgcccaaggacttcggctacagtgcttt
agggttgtccttggctatcttaatgacccaagtgaggacattcaggatccagtgagtgac
aaattcttcaaggaggtgtgggtttcaacagcggctcggaatgctacaatttatgacaag
gtgttccggtgccttcccaatgatgaagtacacaatctaattcagctgagagactttata
aacaagcccgtattagctaaggaagatcccattcgagctgaggaggaactgaagaagatc
cgtggatttttggtgcaattcccctttaatttcttgtctgaagaaagcctactgccttct
gttggaaccaaagaggccatagtgcccatggaggtttggacttaa

KEGG   Pongo abelii (Sumatran orangutan): 100457163
Entry
100457163         CDS       T01416                                 

Gene name
PLD2
Definition
(RefSeq) phospholipase D2
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00564  Glycerophospholipid metabolism
pon00565  Ether lipid metabolism
pon01100  Metabolic pathways
pon04014  Ras signaling pathway
pon04024  cAMP signaling pathway
pon04071  Sphingolipid signaling pathway
pon04072  Phospholipase D signaling pathway
pon04144  Endocytosis
pon04666  Fc gamma R-mediated phagocytosis
pon04724  Glutamatergic synapse
pon04912  GnRH signaling pathway
pon04928  Parathyroid hormone synthesis, secretion and action
pon05200  Pathways in cancer
pon05212  Pancreatic cancer
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100457163 (PLD2)
   00565 Ether lipid metabolism
    100457163 (PLD2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100457163 (PLD2)
   04072 Phospholipase D signaling pathway
    100457163 (PLD2)
   04071 Sphingolipid signaling pathway
    100457163 (PLD2)
   04024 cAMP signaling pathway
    100457163 (PLD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100457163 (PLD2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100457163 (PLD2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100457163 (PLD2)
   04928 Parathyroid hormone synthesis, secretion and action
    100457163 (PLD2)
  09156 Nervous system
   04724 Glutamatergic synapse
    100457163 (PLD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100457163 (PLD2)
   05231 Choline metabolism in cancer
    100457163 (PLD2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    100457163 (PLD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100457163 (PLD2)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     100457163 (PLD2)
Membrane trafficking [BR:pon04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100457163 (PLD2)
 Endosome - Golgi transport
  Others
   Others
    100457163 (PLD2)
SSDB
Motif
Pfam: PX PLDc PLDc_2 PH PH_2
Other DBs
NCBI-GeneID: 100457163
NCBI-ProteinID: XP_002826921
Ensembl: ENSPPYG00000007845
UniProt: A0A6D2XVP9 A0A2J8SPQ2
LinkDB
Position
17
AA seq 933 aa
MMATPESLFPTGDELDSSQLQMESDEVDTLKEGEDPADRMHPFLAIYELQPLKVHPLVFA
PGVPVTAQVVGTERYTSGSKVGTCTLYSVRLTHGDFSWTTKKKFRHFQELHRDLLRHKVL
MSLLPLARFAVAYSPARDAANREMPSLPRADPEGSTRHAASKQKYLENYLNRLLTMSFYR
NYHAMTEFLEVSHLSFIPDLGRKGLEGMIRKRSGGHRVPGLTCCGRDQVCYRWSKRWLVV
KDSFLLYMCLETGAISFVQLFDPGFEVQVGKRSTEARHGVRIDTSHRSLILKCSSYRQAR
WWAQEITELAQGPGRDFLQLHQHDSYAPPRPGTLARWFVNGAGYFAAVADAILRAQEEIF
ITDWWLSPEVYLKRPAHSDDWRLDIMLKRKAEEGVRVSILLFKEVELALGINSGYSKRAL
MLLHPNIKVMRHPDQVTLWAHHEKLLVVDQVVAFLGGLDLAYGRWDDLHYRLTDLGDSSE
SAASQPPTPCPDSPATPDLSHNQFFWLGKDYSNLITKDWVQLDRPFEDFIDRETTPRMPW
RDVGVVVHGLPARDLARHFIQRWNFTKTTKAKYKTPMYPYLLPKSTSTANQLPFTLPGGQ
CTTVQVLRSVDRWSAGTLENSILNAYLNTIRESRHFLYIENQFFISCSDGRTVLNKVGDE
IVDRILKAHKQGQCYRVYVLLPLLPGFEGDISTGGGNSIQAILHFTYRTLCRGEYSILHR
LKAAMGTAWRDYISICGLRTHGELGGHPVSELIYIHSKMLIADDRTVIIGSANINDRSLL
GKRDSELAVLIEDTETEPSLMNGAEYQAGRFALSLRKHCFSVILGANTQPDLDLQDPICD
DFFQLWQDTAESNANIYEQIFRCLPSNATRSLRTLREYVAVEPLATVSPPLARSELTQVQ
GHLVHFPLKFLEDESLLPPLGSKEGMIPLEVWT
NT seq 2802 nt   +upstreamnt  +downstreamnt
atgatggcgacccctgagagcctcttccccactggggacgaattggactccagccagctc
cagatggagtccgatgaggtggacaccctgaaggagggagaggacccagccgaccggatg
cacccgtttctggccatctatgagcttcagcctctgaaagtgcaccccttggtgttcgca
cctggggtccctgtcacagcccaggtggtgggcaccgaaagatataccagcggatccaag
gtgggaacctgcactctgtattctgtccgtttgactcacggcgacttttcctggacaacc
aagaagaaattccgtcattttcaggagctgcatcgggacctcctgagacacaaagtcttg
atgagtctgctccctctggctcgttttgccgttgcctattctccagcccgagatgcagcc
aacagagagatgccctctctaccccgggcagatcctgagggctccaccagacatgcagcc
agcaaacagaaatacctggagaattacctcaaccgtctcttgaccatgtctttctatcgc
aactaccatgccatgacagagttcctggaagtcagtcatctgtcctttatcccagacttg
ggccgcaaaggactggaggggatgatccggaagcgctcaggtggccaccgtgttcccggc
ctcacctgctgtggccgagaccaagtttgttatcgctggtccaagaggtggctggtggtg
aaggactccttcctgctgtacatgtgcctcgagacgggtgccatctcatttgttcagctc
tttgaccctggcttcgaggtgcaggtggggaaaaggagcacggaggcacggcacggcgtg
cggatcgacacctcccacaggtccttgattctcaagtgcagcagctaccggcaggcacgg
tggtgggcccaagagatcactgagctggcacagggcccaggcagagacttcttacagctg
caccagcatgacagctacgccccaccccggcctgggaccttggcccggtggtttgtgaat
ggggcaggttactttgctgctgtagcagatgccatccttcgagctcaagaggagattttc
atcacagactggtggttgagtcctgaggtttacctgaagcgtccggcccattcagatgac
tggagactggacattatgctcaagaggaaggcggaggagggtgtccgcgtgtctattctg
ctgtttaaagaagtggaattggcgttgggcatcaacagtggctatagcaagagggcgctg
atgctgctgcaccccaacataaaggtgatgcgtcacccagaccaagtgacgttgtgggcc
catcatgagaagctcctggtggtagaccaagtggtagcattcctggggggactggacctt
gcctatggccgctgggatgacctgcactaccgactgactgaccttggagactcctctgaa
tcagctgcctcccagcctcccaccccgtgcccagactcgccagccaccccagacctctct
cacaaccaattcttctggctgggcaaggactacagcaatcttatcaccaaggactgggtg
cagctggaccggcctttcgaagatttcattgacagggagacgaccccccggatgccatgg
cgggacgttggggtggtcgtccatggcctacctgcccgggacctcgcccgacacttcatc
cagcgctggaacttcaccaagaccaccaaggccaagtacaagactcccatgtacccctac
ctgcttcccaagtcgaccagcacggccaatcagctccccttcacacttccaggagggcag
tgcaccaccgtacaggtcttgcggtcagtggaccgctggtcagcagggactctggagaac
tccatcctcaatgcctacctgaacaccatcagggagagccggcacttcctctacattgag
aatcagttcttcattagctgctcagatgggcggacggttctgaacaaggtgggcgatgag
attgtggacagaatcctgaaggcccacaaacaggggcagtgttaccgagtctacgtgctt
ttgcccttactccctggcttcgagggtgacatctccacgggcggtggcaactccatccag
gccattctgcactttacttacaggaccctgtgtcgtggggagtattcaatcctgcatcgc
ctcaaagcagccatggggacagcatggcgggactatatttccatctgcgggcttcgtacc
catggagagctaggcgggcaccccgtctcggaactcatctacatccacagcaagatgctc
atcgcagatgaccggacagtcatcatcggttctgcaaacatcaatgaccggagcttgctg
gggaagcgggacagtgagctggccgtgctgatcgaggacacagagacggaaccatccctc
atgaatggggcagagtatcaggcgggcaggtttgccttgagtctgcggaagcactgcttc
agtgtgattcttggagcaaatacccagccagacttggatctccaagaccccatctgtgat
gacttcttccagttgtggcaagacacggctgagagcaacgccaatatctatgagcagatc
ttccgctgcctgccgtccaatgccacgcgttccctgcggactctccgggagtacgtggcc
gtggagcccttggccacagtcagtccccccttggctcggtctgagctcacccaggtccag
ggccacctggtccatttccccctcaagttcctagaggatgagtctttgctgcccccgctg
ggtagcaaggagggcatgatccccctagaagtgtggacatag

DBGET integrated database retrieval system