KEGG   Pongo abelii (Sumatran orangutan): 100439960
Entry
100439960         CDS       T01416                                 

Gene name
FSCN1
Definition
(RefSeq) LOW QUALITY PROTEIN: fascin
  KO
K23551  fascin 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100439960 (FSCN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100439960 (FSCN1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100439960 (FSCN1)
Membrane trafficking [BR:pon04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    100439960 (FSCN1)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     100439960 (FSCN1)
SSDB
Motif
Pfam: Fascin FRG1 DUF5801
Other DBs
NCBI-GeneID: 100439960
NCBI-ProteinID: XP_024097031
Ensembl: ENSPPYG00000017337
LinkDB
Position
7
AA seq 492 aa
MTANGTAEAVQIQFGLINCGNKYLTAEAFGFKVNASASSLKKKQIWTPEQPPDEAGSAAV
CLRSHLGRYLAADKDGNVTCEREVPGPDCRFLIVAHDDGRWSLQSEEHRRYFGGTEDRLS
CFAQTVSPAEKWSVHIAMHPQVNIYSVTRRRXAHLSARPADEIAVDRDVPWGIDSLIILA
FQDQRYSVQTADHRFLRHDGRLVASPEPATGYTLEFRFGKVAFRDCEGPYLAPSGPSNTL
KAGKATKVGKDELFALEQSCAQVVLQAANERNVSTRQGMDLSANQDEETDQETFQLEIDR
DTKKCAFRTHTGKYWTLTATGGVQSTASTKNASCYFDIEWRDRRITLRASNGKFVTSKKN
GQLAASVETAGDSELFLMKLINRPIIVFRGEHGFIGCRKVRGTLDANRSSYDAFQLEFND
GAYNIKDSTGKYWTVGSDSAVTSSGDTPVDFFFEFCDNKVAVKVGGRYLKGDHAGVLKAS
AETVDRASLWQY
NT seq 1479 nt   +upstreamnt  +downstreamnt
atgaccgccaacggcacagccgaggcggtgcagatccagttcggcctcatcaactgcggc
aacaagtacctgacggccgaggcattcgggttcaaggttaacgcgtcggccagcagcctg
aagaagaagcagatctggacgccggagcagccccctgacgaggcgggcagcgcggccgtg
tgcctgcgcagccacctgggccgctacctggcggcggacaaggacggcaacgtgacctgc
gagcgcgaggtgcccggtcccgactgccgcttcctcatcgtggcgcacgacgacggccgc
tggtcgctgcagtccgaggagcaccggcgctacttcggaggcaccgaggaccgcctgtcg
tgcttcgcgcagacggtgtcccccgccgagaagtggagcgtgcacatcgccatgcaccct
caggtcaacatctacagcgtcacccgtaggcgctaggcgcacctgagcgcgcggccggcc
gacgagatcgccgtggaccgcgacgtgccctggggcatcgactcgctcatcatcctcgcc
ttccaggaccagcgctacagcgtgcagaccgccgaccaccgcttcctgcgccatgacggg
cgcctggtggcgagccccgagccggccactggctacacgctggagttccgcttcggcaag
gtggccttccgcgactgcgagggcccttacctggcgccgtcggggcccagcaacacgctc
aaggcgggcaaggccaccaaggtgggcaaagacgagctatttgccctggagcagagctgc
gcccaggtcgtgctgcaggcggccaacgagaggaacgtgtccacgcgccagggtatggac
ctctctgccaatcaggacgaggagaccgaccaggagaccttccagctggagatcgaccgc
gacaccaaaaagtgtgccttccgtacccacacgggcaagtactggacgctgacggccacc
gggggcgtgcagtccaccgcctccaccaagaatgccagctgctacttcgacatcgagtgg
cgtgaccggcgcatcacactgcgggcgtccaatggcaagtttgtgacctctaagaagaat
gggcagctggccgcctcggtggagacagcaggggactcagagctcttcctcatgaagctc
atcaaccgccccatcatcgtgttccgcggggagcacggcttcatcggctgccgcaaggtc
aggggcaccctggacgccaaccgctccagctatgacgccttccagctggagttcaacgat
ggcgcctacaacatcaaagactccacaggcaaatactggacggtgggcagtgactccgcg
gtcaccagcagcggcgacactcctgtggacttcttcttcgagttctgcgacaacaaggtg
gccgtcaaggtgggcgggcgctacctgaagggcgaccacgcaggggtcctgaaggcctcc
gcggagaccgtggaccgcgcctcgctctggcagtactag

DBGET integrated database retrieval system