KEGG   Pongo abelii (Sumatran orangutan): 100440034
Entry
100440034         CDS       T01416                                 

Gene name
IL1R2
Definition
(RefSeq) interleukin-1 receptor type 2
  KO
K04387  interleukin 1 receptor type II
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04640  Hematopoietic cell lineage
pon05146  Amoebiasis
pon05166  Human T-cell leukemia virus 1 infection
pon05202  Transcriptional misregulation in cancer
pon05215  Prostate cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100440034 (IL1R2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100440034 (IL1R2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100440034 (IL1R2)
  09162 Cancer: specific types
   05215 Prostate cancer
    100440034 (IL1R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100440034 (IL1R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100440034 (IL1R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100440034 (IL1R2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100440034 (IL1R2)
   04090 CD molecules [BR:pon04090]
    100440034 (IL1R2)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL1 receptor family
   100440034 (IL1R2)
CD molecules [BR:pon04090]
 Proteins
  100440034 (IL1R2)
SSDB
Motif
Pfam: ig Ig_3 Ig_2 I-set Ig_6 V-set Izumo-Ig Ig_5
Other DBs
NCBI-GeneID: 100440034
NCBI-ProteinID: XP_009234954
LinkDB
Position
2A
AA seq 398 aa
MFRFYVLVMGVSAFTLQPVVHTGAARSCRFRGRHYKREFRLEGEPVALRCPQVPYWLWAS
VSPRINLTWHKNDSARTVPGEEETRMWAQDGALWLLPALQEDSGTYVCTTRNASYCDKMS
IELRVFENTDASLPFISYPQILTLSTSGVLVCPDLREFTRDKTDVKIQWYKDSLLLDKDN
EKFLSVRGTTHLLVHNVALEDAGYYRCVLTFAHEGQQYNITRSIELRIKKKKEETIPVII
SPLKTISASLGSRLTIPCKVFLGTGTPLTTMLWWTANDTHIESAYPGGRVTEGPRQEYSE
NNENYIEVPLIFDPVTREDLHMDFKCVVHNTVSFQTLRTTVKEASSTFSWGIVLAPLSLA
FLVLGGIWMHRRCKHRTGKADGLTVLWPRHQDFQSYPK
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgttccgcttctacgtgttggttatgggagtttctgccttcacccttcagcctgtggta
cacacaggggctgccagaagctgccggtttcgtgggcggcattacaagcgggagttcagg
ctggaaggggagcctgtggccctgaggtgcccccaggtgccctactggttgtgggcctct
gtcagcccccgcatcaacctgacatggcataaaaatgactctgctaggacggtcccagga
gaagaagagacacggatgtgggcccaggacggtgctctgtggcttctgccagccttgcag
gaggactctggcacctacgtctgcactactagaaatgcttcttactgtgacaaaatgtcc
attgagctcagagtttttgagaacacagatgcttccctgccgttcatctcatacccgcaa
attttaaccttgtcaacctctggggtattagtatgccctgacctgagggaattcacccgt
gacaaaactgacgtgaagattcaatggtacaaggattctcttcttttggataaagacaat
gagaaatttctaagtgtgagggggaccactcacttactcgtacacaatgtggccctggaa
gatgcgggctattaccgctgtgtcctgacatttgcccatgaaggccagcaatacaacatc
actaggagtattgagctacgcatcaagaaaaaaaaagaagagacaattcctgtgatcatt
tcccccctcaagaccatatcagcttctctggggtcaagactgacaatcccgtgtaaggtg
tttctgggaaccggcacacccttaaccaccatgctgtggtggacggccaatgatacccac
atagagagcgcctacccgggaggccgcgtgactgaggggccacgccaggaatattcagaa
aacaatgagaactacattgaagtgccattgatctttgatcctgtcacaagagaggatttg
cacatggattttaaatgtgttgtccataatactgtgagttttcagacactacgcaccaca
gtcaaggaagcctcctccacgttctcctggggcattgtgctggccccactttcactggcc
ttcttggttttggggggaatatggatgcacagacggtgcaaacacagaactggaaaagca
gatggtctgactgtgctatggcctcgtcatcaagactttcaatcctatcccaagtaa

DBGET integrated database retrieval system