KEGG   Pongo abelii (Sumatran orangutan): 100440043
Entry
100440043         CDS       T01416                                 

Gene name
NF1
Definition
(RefSeq) neurofibromin isoform X1
  KO
K08052  neurofibromin 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100440043 (NF1)
   04014 Ras signaling pathway
    100440043 (NF1)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100440043 (NF1)
SSDB
Motif
Pfam: RasGAP CRAL_TRIO_2 CRAL_TRIO MOR2-PAG1_C MIF4G_like_2
Other DBs
NCBI-GeneID: 100440043
NCBI-ProteinID: XP_024091410
Ensembl: ENSPPYG00000008147
LinkDB
Position
17
AA seq 2839 aa
MAAHRPVEWVQAVVSRFDEQLPIKTGQQNTHTKVSTEHNKECLINISKYKFSLVISGLTT
ILKNVNNMRIFGEAAEKNLYLSQLIILDTLEKCLAGQPKDTMRLDETMLVKQLLPEICHF
LHTCREGNQHAAELRNSASGVLFSLSCNNFNAVFSRISTRLQELTVCSEDNVDVHDIELL
QYINVDCAKLKRLLKETAFKFKALKKVAQLAVINSLEKAFWNWVENYPDEFTKLYQIPQT
DMAECAEKLFDLVDGFAESTKRKAAVWPLQIILLILCPEIIQDISKDVVDENNMNKKLFL
DSLRKALAGHGGSRQLTESAAIACVKLCKASTYINWEDNSVIFLLVQSMVVDLKNLLFNP
SKPFSRGSQPADVDLMIDCLVSCFRISPHNNQHFKICLAQNSPSTFHYVLVNSLHRIITN
SALDWWPKIDAVYCHSVELRNMFGETLHKAVQGCGAHPAIRMAPSLTFKEKVTSLKFKEK
PTDLETRSYKYLLLSMVKLIHADPKLLLCNPRKQGPETQGSTAELITGLVQLVPQSHMPE
IAQEAMEALLVLHQLDSIDLWNPDAPVETFWEISSQMLFYICKKLTSHQMLSSTEILKWL
REILICRNKFLLKNKQADRSSCHFLLFYGVGCDIPSSGNTSQMSMDHEELLRTPGASLRK
GKGNSSMDSAAGCSGTPPICRQAQTKLEVALYMFLWNPDTEAVLVAMSCFRHLCEEADIR
CGVDEVSVHNLLPNYNTFMEFASVSNMMSTGRAALQKRVMALLRRIEHPTAGNTEAWEDT
HAKWEQATKLILNYPKAKMEDGQAAESLHKTIVKRRMSHVSGGGSIDLSDTDSLQEWINM
TGFLCALGGVCLQQRSNSGLATYSPPMGPVSERKGSMISVMSSEGNADTPVSKFMDRLLS
LMVCNHEKVGLQIRTNVKDLVGLELSPALYPMLFNKLKNTISKFFDSQGQVLLTDTNTQF
VEQTIAIMKNLLDNHTEGSSEHLGQASIETMMLNLVRYVRVLGNMVHAIQIKTKLCQLVE
VMMARRDDLSFCQEMKFRNKMVEYLTDWVMGTSNQAADDDVKCLTRDLDQASMEAVVSLL
AGLPLQPEEGDGVELMEAKSQLFLKYFTLFMNLLNDCSEVEDESAQTGGRKRGMSRRLAS
LRHCTVLAMSNLLNANVDSGLMHSIGLGYHKDLQTRATFMEVLTKILQQGTEFDTLAETV
LADRFERLVELVTMMGDQGELPIAMALANVVPCSQWDELARVLVTLFDSRHLLYQLLWNM
FSKEVELADSMQTLFRGNSLASKIMTFCFKVYGATYLQKLLDPLLRIVITSADWQHVSFE
VDPTRLEPSESLEENQRNLLQMTEKFFHAIISSSSEFPPQLRSVCHCLYQATCHSLLNKA
TVKEKKENKKSVVSQRFPQNSIGAVGSAMFLRFINPAIVSPYEAGILDKKPPPRIERGLK
LMSKILQSIANHVLFTKEEHMRPFNDFVKSNFDAARRFFLDIASDCPTSDAVNHSLSFIS
DGNVLALHRLLWNNQEKIGQYLSSNRDHKAVGRRPFDKMATLLAYLGPPEHKPVADTHWS
SLNLTSSKFEEFMTRHQVHEKEEFKALKTLSIFYQAGTSKAGNPIFYYVARRFKTGQING
DLLIYHVLLTLKPYYAKPYEIVVDLTHTGPSNRFKTDFLSKWFVVFPGFAYDNVSAVYIY
NCNSWVREYTKYHERLLTGLKGSKRLVFIDCPGKLAEHIEHEQQKLPAATLALEEDLKVF
HNALKLAHKDTKVSIKVGSTAVQVTSAERTKVLGQSVFLNDIYYASEIEEICLVDENQFT
LTIANQGTPLTFMHQECEAIVQSIIHIRTRWELSQPDSIPQHTKIRPKDVPGTLLNIALL
NLGSSDPSLRSAAYNLLCALTCTFNLKIEGQLLETSGLCIPANNTLFIVSISKTLAANEP
HLTLEFLEECISGFSKSSIELKHLCLEYMTPWLSNLVRFCKHNDDAKRQRVTAILDKLIT
MTINEKQMYPSIQAKIWGSLGQITDLLDVVLDSFIKTSATGGLGSIKAEVMADTAVALAS
GNVKLVSSKVIGRMCKIIDKTCLSPTPTLEQHLMWDDIAILARYMLMLSFNNSLDVAAHL
PYLFHVVTFLVATGPLSLRASTHGLVINIIHSLCTCSQLHFSEETKQVLRLSLTEFSLPK
FYLLFGISKVKSAAVIAFRSSYRDRSFSPGSYERETFALTSLETVTEALLEIMEACMRDI
PTCKWLDQWTELAQRFAFQYNPSLQPRALVVFGCISKRVSHGQIKQIIRILSKALESCLK
GPDTYNSQVLIEATVIALTKLQPLLNKDSPLHKALFWVAVAVLQLDEVNLYSAGTALLEQ
NLHTLDSLRIFNDKSPEEVFMAIRNPLEWHCKQMDHFVGLNFNSNFNFALVGHLLKGYRH
PSPAIVARTVRILHTLLTLVNKHRNCDKFEVNTQSVAYLAALLTVSEEVRSRCSLKHRKS
LLLTDISMENVPMDTYPIHHGDPTYRTLKETQPWSSPKGSEGYLAATYPTVGQTSPRARK
SMSLDMGQPSQANTKKLLGTRKSFDHLISDTKAPKRQEMESGITTPPKMRRVAETDYEME
TQRISSSQQHPHLRKVSVSESNVLLDEEVLTDPKIQALLLTVLATLVKYTTDEFDQRILY
EYLAEASVVFPKVFPVVHNLLDSKINTLLSLCQDPNLLNPIHGIVQSVVYHEESPPQYQT
SYLQSFGFNGLWRFAGPFSKQTQIPDYAELIVKFLDALIDTYLPGIDEETSEESLLTPTS
PYPPALQSQLSITANLNLSNSMTSLATSQHSPGIDKENVELSPTTGHCNSGRTRHGSASQ
VQKQRSAGSFKRNSIKKIV
NT seq 8520 nt   +upstreamnt  +downstreamnt
atggccgcgcacaggccggtggaatgggtccaggccgtggtcagccgcttcgacgagcag
cttccaataaaaacaggacagcagaacacgcataccaaagtcagtactgagcacaacaag
gaatgtctaatcaatatttccaaatacaagttttctttggttataagcggcctcactact
attttaaagaatgttaacaatatgagaatatttggagaagctgctgaaaaaaatttatat
ctctctcagttgataatattggatacactggaaaaatgtcttgctgggcaaccaaaggac
acaatgagattagatgaaacgatgctggtcaaacagttgctgccagaaatctgccatttt
cttcacacctgtcgtgaaggaaaccagcatgcagctgaacttcggaattctgcctctggg
gttttattttctctcagctgcaacaacttcaatgcagtctttagtcgcatttctaccagg
ttacaggaattaactgtttgttcagaagacaatgttgatgttcatgatatagaattgtta
cagtatatcaatgtggattgtgcaaaattaaaacgactcctgaaggaaacagcatttaaa
tttaaagccctaaagaaggttgcgcagttagcagttataaatagcctggaaaaggcattt
tggaactgggtagaaaattatccagatgaatttacaaaactataccagatcccacagact
gatatggctgaatgtgcagaaaagctatttgacttggtggatggttttgctgaaagcacc
aaacgtaaagcagcagtttggccactacaaatcattctccttatcttgtgtccagagata
atccaggatatatccaaagatgtggttgatgaaaacaacatgaataagaagttatttctg
gacagtctacgaaaagctcttgctggccatggaggaagtaggcagctgacagaaagtgct
gcaattgcctgtgtcaaactgtgtaaagcaagtacctacatcaattgggaagataactct
gtcattttcctacttgttcagtccatggtggttgatcttaagaacctgctttttaatcca
agtaagccattctcaagaggcagtcagcctgcagatgtggatctaatgattgactgcctt
gtttcttgctttcgtataagccctcacaacaaccaacactttaagatctgcctggctcag
aattcaccttctacatttcactatgtgctggtaaattcactccatcgaatcatcaccaat
tctgcattggattggtggcctaagattgatgctgtgtattgtcactcggttgaacttcga
aatatgtttggtgaaacacttcataaagcagtgcaaggttgtggagcacacccagcaata
cgaatggcaccgagtcttacatttaaagaaaaagtaacaagccttaaatttaaagaaaaa
cctacagacctggagacaagaagctataagtatcttctcttgtccatggtgaaactaatt
catgcagatccaaagctcttgctttgtaatccaagaaaacaggggcccgaaacccaaggc
agtacagcagaattaattacagggctcgtccaactggtccctcagtcacacatgccagag
attgctcaggaagcaatggaggctctgctggttcttcatcagttagatagcattgatttg
tggaatcctgatgctcctgtagaaacattttgggagattagctcacaaatgcttttttac
atctgcaagaaattaactagtcatcaaatgcttagtagcacagaaattctcaagtggttg
cgggaaatattgatctgcaggaataaatttcttcttaaaaataagcaggcagatagaagt
tcctgtcactttctccttttttacggggtaggatgtgatattccttctagtgggaatacc
agtcaaatgtccatggatcatgaagaattactacgtactcctggagcctctctccggaag
ggaaaagggaactcctctatggatagtgcagcaggatgcagtggaacccccccgatttgc
cgacaagcccagaccaaactagaagtggccctgtacatgtttctgtggaaccctgacact
gaagctgttctggttgccatgtcctgtttccgccacctctgtgaggaagcagatatccgg
tgtggggtggatgaagtgtcagtgcataacctcttgcccaactataacacattcatggag
tttgcctctgtcagcaatatgatgtcaacaggaagagcagcacttcagaaaagagtaatg
gcactgctgaggcgcattgagcatcccactgcaggaaacactgaggcttgggaagataca
catgcaaaatgggaacaagcaacaaaactaatccttaactatccaaaagccaaaatggaa
gatggccaggctgctgaaagccttcacaagaccattgttaagaggcgaatgtcccatgtg
agtggaggaggatccatagatttgtctgacacagactccctacaggaatggatcaacatg
actggcttcctttgtgcccttgggggagtgtgcctccagcagagaagcaattctggcctg
gcaacctatagcccacccatgggtccagtcagtgaacgtaagggttctatgatttcagtg
atgtcctcagagggaaacgcagatacacctgtcagcaaatttatggatcggctgttgtcc
ttaatggtgtgtaaccatgagaaagtgggacttcaaatacggaccaatgttaaggatctg
gtgggtctagaattgagtcctgctctgtatccaatgctatttaacaaattgaagaatacc
atcagcaagttttttgactcccaaggacaggttttattgactgataccaatactcaattt
gtagaacaaaccatagctataatgaagaacttgctagataatcatactgaaggcagctct
gaacatctagggcaagctagcattgaaacaatgatgttaaatctggtcaggtatgttcgt
gtgcttgggaatatggtccatgcaattcaaataaaaacgaaactgtgtcaattagttgaa
gtaatgatggcaaggagagatgacctctcattttgccaagagatgaaatttaggaataag
atggtagaatacttgacagactgggttatggggacatcaaaccaagcagcagatgatgat
gtaaaatgtcttacaagagatttggaccaggcaagcatggaagcagtagtttcacttcta
gctggtctccctctgcagcctgaagaaggagatggtgtggaattgatggaagccaaatcg
cagttatttcttaaatacttcacattatttatgaaccttttgaatgactgcagtgaagtt
gaagatgaaagtgcacaaacaggtggcaggaaacgtggcatgtctcggaggctggcatca
ctgaggcactgtacagtccttgcaatgtcaaacttactcaatgccaacgtagacagtggt
ctcatgcactccataggcttaggttaccacaaggatctccagacaagagctacatttatg
gaagttctgacaaaaatccttcaacaaggcacagaatttgacacacttgcagaaacggta
ttggctgatcggtttgagagattggtggaactggtcacaatgatgggtgatcaaggagaa
ctccctatagcgatggctctggccaatgtggttccttgttctcagtgggatgaactagct
cgagttctggttactctgtttgattctcggcatttactctaccaactgctctggaacatg
ttttctaaagaagtagaattggcagactccatgcagactctcttccgaggcaacagcttg
gccagtaaaataatgacattctgtttcaaggtatatggtgctacctatctacaaaaactc
ctggatcctttattacgaattgtgatcacatccgctgattggcaacatgttagctttgaa
gtggatcctaccaggttagaaccatcagagagccttgaggaaaaccagcggaacctcctt
cagatgactgaaaagttcttccatgccatcatcagttcctcttcagaattcccccctcaa
cttcgaagtgtgtgccactgtttataccaggcaacttgccactccctactgaataaagct
acagtaaaagaaaaaaaggaaaacaaaaaatcagtggttagccagcgtttccctcagaac
agcatcggtgcagtaggaagtgccatgttcctcagatttatcaatcctgccattgtctca
ccgtatgaagcagggattttagataaaaagccaccacctagaatcgaaagaggcttgaag
ttaatgtcaaagatacttcagagtattgccaatcatgttctcttcacaaaagaagaacat
atgcggcctttcaatgattttgtgaaaagcaactttgatgcagcacgaaggtttttcctt
gatatagcatctgattgtcctacaagtgatgcagtaaatcatagtctttccttcatcagt
gacggcaatgtgcttgctttacatcgtctactctggaacaatcaggagaaaattggccag
tatctttccagcaacagggatcataaagctgttggaagacgaccttttgataagatggca
acacttcttgcatacctgggtcctccagagcacaaacctgtggcagatacacactggtcc
agccttaaccttaccagttcaaagtttgaggaatttatgactaggcatcaggtacatgaa
aaagaagaattcaaagctttgaaaacgttaagtattttctaccaagctgggacttccaaa
gctgggaatcctattttttattatgttgcacggaggttcaaaactggtcaaatcaatggt
gatttgctgatataccatgtcttactgactttaaagccatattatgcaaagccatatgaa
attgtagtggaccttacccataccgggcctagcaatcgctttaaaacagactttctctct
aagtggtttgttgtttttcctggctttgcttacgacaacgtctccgcagtctatatctat
aactgtaattcctgggtcagggagtacactaagtatcatgagcggctgctgactggcctc
aaaggtagcaaaaggcttgttttcatagactgtcctgggaaactggctgagcacatagag
catgaacaacagaaactacctgctgccaccttggctttagaagaggacctgaaggtattc
cacaatgctctcaagctagctcacaaagacaccaaagtttctattaaagttggttctact
gctgtccaagtaacctcagcagagcgaacaaaagtcctagggcaatcagtctttctaaat
gacatttattatgcttcggaaattgaagaaatctgcctagtagatgagaaccagttcacc
ttaacgattgcaaaccagggcacaccgctcaccttcatgcaccaggagtgtgaagccatt
gtccagtctatcattcatatccggactcgctgggaactgtcacagcccgactctatcccc
caacacaccaagattcggccaaaagatgtccctgggacactgctcaatatcgcattactt
aatttaggcagttctgacccgagtttacggtcagctgcctataatcttctgtgtgcctta
acttgtacctttaatttaaaaatcgagggccagttactagagacatcaggtttatgtatt
cctgccaacaacaccctctttattgtctctattagtaagacactggcagccaatgagcca
caccttacattagaatttttggaagagtgtatttctggatttagcaaatctagtattgaa
ttgaaacacctttgtttggaatacatgactccatggctgtcaaatctagttcgtttttgc
aagcataatgatgatgccaaacgacaaagagttactgctattcttgacaagctgataaca
atgaccatcaatgaaaaacagatgtacccatctattcaagcaaaaatatggggaagcctt
gggcagattacagatctgcttgatgttgtactagacagtttcatcaaaaccagtgcaaca
ggtggcttgggatcaataaaagctgaggtgatggcagatactgctgtagctttggcttct
ggaaatgtgaaattggtttcaagcaaggttattggaaggatgtgcaaaataattgacaag
acatgcttatctccaactcctactttagaacaacatcttatgtgggatgatattgctatt
ttagcacgctacatgctgatgctgtccttcaacaattcccttgatgtggcagctcatctt
ccctacctcttccacgttgttactttcttagtagccacaggtccgctctcccttagagct
tccacacatggactggtcattaatatcattcactctctgtgtacttgttcacagcttcat
tttagtgaagagaccaagcaagttttgagactcagtctgacagagttctcattacccaaa
ttttacttgctgtttggcattagcaaagtcaagtcagctgctgtcattgccttccgttcc
agttaccgggacaggtcattctctcctggctcctatgagagagagacttttgctttgaca
tccttggaaacagtcacagaagctttgttggagatcatggaggcatgcatgagagatatt
ccaacgtgcaagtggctggaccagtggacagaactagctcaaagatttgcattccaatat
aatccatccctgcaaccaagagctcttgttgtctttgggtgtattagcaaacgagtgtct
catgggcagataaagcagataatccgtattcttagcaaggcacttgagagttgcttaaaa
ggacctgacacttacaacagtcaagttctgatagaagctacagtaatagcactaaccaaa
ttacagccacttcttaataaggactcgcctctgcataaagccctcttttgggtagctgtg
gctgtgctgcagcttgatgaggtcaacttgtattcagcaggcaccgcacttcttgaacaa
aacctgcatactttagatagtctccgtatattcaatgacaagagtccagaggaagtattt
atggcaatccggaatcctctggagtggcactgcaagcaaatggatcattttgttggactc
aatttcaactctaactttaactttgcattggttggacaccttttaaaagggtacaggcat
ccttcacctgccattgttgcaagaacagtcagaattttacatacactactaactctggtt
aacaaacacagaaattgtgacaaatttgaagtgaatacacagagcgtggcctacttagca
gctttacttacagtgtctgaagaagttcgaagtcgctgcagcctaaaacatagaaagtca
cttcttcttactgatatttcaatggaaaatgttcctatggatacatatcccattcatcat
ggtgaccctacctataggacactgaaggagactcagccatggtcctctcccaaaggttct
gagggataccttgcagccacctatccaactgtcggccagaccagtccccgagccaggaaa
tccatgagcctggacatggggcagccttctcaagccaacactaagaagttgcttggaaca
aggaaaagttttgatcacttgatatcagacacaaaggctcctaaaaggcaagaaatggaa
tcagggatcacaacaccccccaaaatgaggagagtagcagaaactgattatgaaatggaa
actcagaggatttcctcatcacaacagcacccacatttacgtaaggtttcagtgtctgaa
tcaaatgttctcttggatgaagaagtacttactgatccgaagatccaggcgctgcttctt
actgttctagctacactggtaaaatataccacagatgagtttgatcaacgaattctttat
gaatacttagcagaggccagtgttgtgtttcccaaagtctttcctgttgtgcataatttg
ttggactctaagatcaacaccctgttatcattgtgccaagatccaaatttgttaaatcca
atccatggaattgtgcagagtgtggtgtaccatgaagaatccccaccacaataccaaaca
tcttacctgcaaagttttggttttaatggcttgtggcggtttgcaggacccttttcaaag
caaacacaaattccagactatgctgagcttattgttaagtttcttgatgccttgattgac
acgtacctgcctggaattgatgaagaaaccagtgaggaatccctcctgacacccacatct
ccttaccctcctgcactgcagagccagcttagtatcactgccaaccttaacctctctaat
tccatgacctcacttgcaacttcccagcattccccaggaatcgacaaggagaacgttgaa
ctctcccctaccactggccactgtaacagtggacgaactcgccacggatccgcaagccaa
gtgcagaagcaaagaagcgctggcagtttcaaacgtaatagcattaagaagatcgtgtga

DBGET integrated database retrieval system