KEGG   Pongo abelii (Sumatran orangutan): 100440212Help
Entry
100440212         CDS       T01416                                 

Gene name
PDGFA
Definition
(RefSeq) platelet-derived growth factor subunit A isoform X1
  KO
K04359  platelet-derived growth factor subunit A
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04072  Phospholipase D signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04540  Gap junction
pon04630  Jak-STAT signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05206  MicroRNAs in cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05231  Choline metabolism in cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100440212 (PDGFA)
   04015 Rap1 signaling pathway
    100440212 (PDGFA)
   04010 MAPK signaling pathway
    100440212 (PDGFA)
   04630 Jak-STAT signaling pathway
    100440212 (PDGFA)
   04072 Phospholipase D signaling pathway
    100440212 (PDGFA)
   04151 PI3K-Akt signaling pathway
    100440212 (PDGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100440212 (PDGFA)
   04540 Gap junction
    100440212 (PDGFA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100440212 (PDGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100440212 (PDGFA)
   05202 Transcriptional misregulation in cancer
    100440212 (PDGFA)
   05206 MicroRNAs in cancer
    100440212 (PDGFA)
   05231 Choline metabolism in cancer
    100440212 (PDGFA)
  09162 Cancer: specific types
   05214 Glioma
    100440212 (PDGFA)
   05218 Melanoma
    100440212 (PDGFA)
   05215 Prostate cancer
    100440212 (PDGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100440212 (PDGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100440212 (PDGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100440212 (PDGFA)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100440212 (PDGFA)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100440212 (PDGFA)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   100440212 (PDGFA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDGF_N PDGF
Motif
Other DBs
NCBI-GeneID: 100440212
NCBI-ProteinID: XP_024097071
LinkDB All DBs
Position
7
AA seq 220 aa AA seqDB search
MRTLACLLLLGCGYLAHVLAEEAEIPREVIERLAHSQIHSIRDLQRLLEIDSVGSEESLD
TSLRVHGVHATKHASEKRPLPIRRKRSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIW
PPCVEVKRCTGCCNTSSVKCQPSRIHHRSVKVAKVEYIRKKPKLKEVQVRLEEHLECACA
TTSLNPDYREEDTGEWLPSSASVLENRSSEPCFWGVRWPP
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgaggaccttggcttgcctgctgctcctcggctgcggatacctcgcccatgttctggcc
gaggaagccgagatcccccgcgaggtgatcgagaggctggcgcacagtcagatccacagc
atccgggacctccagcgactcctggagatagactccgtagggagtgaggagtctttggac
accagcctgagagttcacggggtccacgccactaagcatgcgtccgagaagcggcccctg
cccattcgaaggaagagaagcatcgaggaagctgtccccgctgtctgcaagaccaggacg
gtcatttacgagattcctcggagtcaggttgaccccacgtccgccaacttcctgatctgg
cccccgtgcgtggaggtgaaacgctgcaccggctgctgcaacaccagcagcgtcaagtgc
cagccctcacgcatccaccaccgcagtgtcaaggtcgccaaggtggaatacatcaggaag
aagccaaaattaaaagaagtccaggtgaggttagaggagcatttggagtgcgcctgcgcg
accaccagcctgaatccggattatcgggaagaggacacgggtgagtggctgccttcatcg
gcatcagtgttggagaacaggtcttcagagccgtgcttttggggtgttaggtggccccct
tga

KEGG   Pongo abelii (Sumatran orangutan): 100460243Help
Entry
100460243         CDS       T01416                                 

Gene name
PDGFB
Definition
(RefSeq) platelet-derived growth factor subunit B
  KO
K17386  platelet-derived growth factor subunit B
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04072  Phospholipase D signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04540  Gap junction
pon04630  Jak-STAT signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05200  Pathways in cancer
pon05206  MicroRNAs in cancer
pon05211  Renal cell carcinoma
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05231  Choline metabolism in cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100460243 (PDGFB)
   04015 Rap1 signaling pathway
    100460243 (PDGFB)
   04010 MAPK signaling pathway
    100460243 (PDGFB)
   04630 Jak-STAT signaling pathway
    100460243 (PDGFB)
   04072 Phospholipase D signaling pathway
    100460243 (PDGFB)
   04151 PI3K-Akt signaling pathway
    100460243 (PDGFB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100460243 (PDGFB)
   04540 Gap junction
    100460243 (PDGFB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100460243 (PDGFB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100460243 (PDGFB)
   05206 MicroRNAs in cancer
    100460243 (PDGFB)
   05231 Choline metabolism in cancer
    100460243 (PDGFB)
  09162 Cancer: specific types
   05214 Glioma
    100460243 (PDGFB)
   05218 Melanoma
    100460243 (PDGFB)
   05211 Renal cell carcinoma
    100460243 (PDGFB)
   05215 Prostate cancer
    100460243 (PDGFB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100460243 (PDGFB)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100460243 (PDGFB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100460243 (PDGFB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100460243 (PDGFB)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100460243 (PDGFB)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100460243 (PDGFB)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   100460243 (PDGFB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDGF PDGF_N
Motif
Other DBs
NCBI-GeneID: 100460243
NCBI-ProteinID: XP_002831201
Ensembl: ENSPPYG00000011836
UniProt: H2P4F5
LinkDB All DBs
Position
22
AA seq 241 aa AA seqDB search
MNRCWALFLYLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAEL
DLNMTRSHSGDELESLARGRRSLGSLTVAEPAMIAECKTRTEVFEISRRLIDRTNANFLV
WPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKC
ETVAAARPVTRSPGGSQDQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLG
A
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgctgctgggcgctcttcctgtatctctgctgctacctgcgtctggtcagcgcc
gagggggaccccattcccgaggagctctatgagatgctgagtgaccactcgatccgctcc
ttcgatgatctccagcgcctgctgcacggagaccccggagaggaagatggggccgagttg
gacctgaacatgacccgctcccactctggagacgagctggagagcttggctcgtggaaga
aggagcctgggttctctgaccgttgctgagccggccatgatcgctgagtgcaagacgcgc
accgaggtgttcgagatctcccggcgcctcatagaccgcaccaatgccaacttcctggtg
tggccgccctgcgtggaggtgcagcgctgctccggctgctgcaacaaccgcaacgtgcag
tgccgccccacccaggtgcagctgcgacctgtccaggtgagaaagatcgagattgtgcgg
aagaagccaatctttaagaaggccacggtgacgctggaggaccacctggcatgcaagtgt
gagacagtggcggctgcacggcctgtgacccgaagcccggggggttcccaggaccagcga
gccaaaacgccccaaactcgggtgaccattcggacggtgcgagtccgccggccccctaag
ggcaagcaccggaaattcaagcacacgcatgacaagacggcactgaaggagaccctcgga
gcctag

DBGET integrated database retrieval system