KEGG   Pongo abelii (Sumatran orangutan): 100440279
Entry
100440279         CDS       T01416                                 

Definition
(RefSeq) junction plakoglobin
  KO
K10056  junction plakoglobin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05221  Acute myeloid leukemia
pon05226  Gastric cancer
pon05412  Arrhythmogenic right ventricular cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100440279
   05202 Transcriptional misregulation in cancer
    100440279
  09162 Cancer: specific types
   05226 Gastric cancer
    100440279
   05221 Acute myeloid leukemia
    100440279
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100440279
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100440279
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100440279
SSDB
Motif
Pfam: Arm HEAT V-ATPase_H_N Cnd1 Adaptin_N HEAT_2 Atx10homo_assoc DUF3361 KAP Arm_2 PUL
Other DBs
NCBI-GeneID: 100440279
NCBI-ProteinID: XP_024090651
LinkDB
Position
17
AA seq 745 aa
MEVMNLMEQPIKVTEWQQTYTYDSGIHSGANTCVPSVSSKGIMEEDEACGRQYTLKKTTT
YTQGVPPSQGDLEYQMSTTARAKRVREAMCPGVSGEDSSLLLATQVEGQATNLQRLAEPS
QLLKSAIVHLINYQDDAELATRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALM
GSPQLVAAVVRTMQNTSDLDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVE
SVLFYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQ
ESKLIILANGGPQALVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQALGKH
LTSNSPRLVQNCLWTLRNLSDVATKQEGLESVLKILVNQLSVDDVNVLTCATGTLSNLTC
NNSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNY
GIPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQR
HVAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLYSSVENI
QRVAAGVLCELAQDKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLFRISEDKNPDY
RKRVSVELTNSLFKHDPAAWEAAQSMIPINEPYGDDMDATYRPMYSSDVPLDPLEMHMDM
DGDYPIDTYSDGLRPPYPTADHMLA
NT seq 2238 nt   +upstreamnt  +downstreamnt
atggaggtgatgaacctgatggagcagcctatcaaggtgactgagtggcagcagacatac
acctacgactccggtatccactcgggcgccaacacctgcgtgccctccgtcagcagcaag
ggcatcatggaggaggatgaggcctgtggccgccaatacacgctcaagaaaaccaccacc
tacacccagggggtgccccccagccaaggtgacctggagtaccagatgtccacaacagcc
agggccaaacgggtgcgggaggccatgtgccctggtgtgtcaggcgaggacagctcgctc
ctgctggccacccaggtggaggggcaggccaccaacctgcagcgactggccgagccgtcc
cagctgctcaagtcggccatcgtgcatctcatcaactaccaggatgatgccgagctggcc
actcgcgccttgcccgagctcaccaaactgctcaacgatgaggacccggtggtggtgacc
aaggcggccatgattgtgaaccagctgtcgaagaaggaggcatcgcggcgggccctgatg
ggctcgccccagctggtggccgctgtcgtgcgcaccatgcagaataccagcgacctggac
acggcccgctgcaccaccagcatcctgcacaacctctcccaccaccgggaggggctgctc
gccatcttcaagtcgggcggcatccctgctctggtccgcatgctcagttcccctgtggag
tcggtcctgttctatgccatcaccacgctgcacaacctgctcctgtaccaggagggcgcc
aagatggccgtgcgcctggccgacgggctgcaaaagatggtgcccctgctcaacaagaac
aaccccaagttcctggccatcaccaccgattgcctgcagctcctggcctacggcaaccag
gagagcaagctgatcatcctggccaatggtgggccccaggccctcgtgcagatcatgcgt
aactacagttatgagaagctgctctggaccaccagtcgtgtgctcaaggtgctgtccgtg
tgtcccagcaataagcctgccatcgtggaggctggtgggatgcaggccctgggcaagcac
ctgaccagcaacagcccccgcctggtgcagaactgcctgtggaccctgcgcaacctctcg
gacgtggccaccaagcaggagggcctggagagcgtactaaagattctggtgaaccagctg
agtgtggatgacgtcaacgtcctcacctgtgccacgggcacactctccaacctgacatgc
aacaacagcaagaacaagacgctggtgacacagaacagcggtgtggaggctctcatccat
gccatcctgcgtgctggtgacaaggacgacatcacggagcctgccgtctgtgccctgcgc
cacctcactagccgccaccctgaggccgagatggcccagaactctgtgcgtctcaactat
ggcatcccggccatcgtgaagctgctcaaccagcccaaccagtggccactggtcaaggca
accattggcttgataaggaatctggccctgtgcccagccaaccatgccccactgcaggag
gcagcggtcatcccccgccttgtccaactgctggtcaaggcccaccaggatgcccagcgc
cacgtagctgcaggcacacagcagccctacacggatggtgtgaggatggaggagattgtg
gagggctgcaccggagccctgcacatcctcgcccgggaccccatgaaccgcatggagatc
ttccggctcaacaccattcctctgtttgtgcagctcctgtactcgtcggtggagaacatc
cagcgcgtggctgccggggtgctgtgtgagctggcccaggacaaggaggcggccgacgcc
attgatgcagagggggcctcggccccactcatggagttgctgcactcccgcaacgagggc
actgccacctacgctgctgccgtcctgttccgcatctccgaggacaagaacccagactac
cggaagcgcgtgtccgtggagctcaccaattccctcttcaagcatgacccggctgcctgg
gaggctgcccagagcatgattcccatcaatgagccctacggagatgacatggatgccacc
taccgccccatgtactccagcgatgtgccccttgacccgctggagatgcacatggacatg
gacggagactaccccatcgacacctacagcgacggcctcaggcccccgtaccccactgca
gaccacatgctggcctag

DBGET integrated database retrieval system