KEGG   Pongo abelii (Sumatran orangutan): 100440463
Entry
100440463         CDS       T01416                                 

Gene name
LEP
Definition
(RefSeq) leptin isoform X1
  KO
K05424  leptin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04080  Neuroactive ligand-receptor interaction
pon04152  AMPK signaling pathway
pon04630  JAK-STAT signaling pathway
pon04920  Adipocytokine signaling pathway
pon04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100440463 (LEP)
   04152 AMPK signaling pathway
    100440463 (LEP)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100440463 (LEP)
   04060 Cytokine-cytokine receptor interaction
    100440463 (LEP)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100440463 (LEP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100440463 (LEP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100440463 (LEP)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  CSF and other factors
   100440463 (LEP)
SSDB
Motif
Pfam: Leptin
Other DBs
NCBI-GeneID: 100440463
NCBI-ProteinID: XP_002818456
Ensembl: ENSPPYG00000017974
UniProt: H2PNF0 A0A663DCY8
LinkDB
Position
7
AA seq 167 aa
MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTVITRINDISHTQSVSSKQKVTGL
DFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLP
WASGLETLDRLGGVLEASGYSTEVVALSRLQRSLQDMLWQLDLSPGC
NT seq 504 nt   +upstreamnt  +downstreamnt
atgcattggggaacgctgtgcggattcttgtggctttggccctatcttttctacgtccaa
gctgtgcccatccaaaaagtccaagatgacaccaaaaccctcatcaagacagttatcacc
aggatcaatgacatttcacacacgcagtcagtctcctccaaacagaaggtcaccggtttg
gacttcattcctgggctccaccccatcctgaccttatccaagatggaccagacactggca
gtctaccaacagatcctcaccagtatgccttccagaaacgtgatccaaatatccaacgac
ctggagaacctccgggaccttcttcacgtgctggccttctctaagagctgccacttgccc
tgggccagtggcctggagaccttggacaggctggggggtgtcctggaagcttcaggctac
tccacagaggtggtggcccttagcaggctgcagcggtctctgcaggacatgctgtggcag
ctggacctcagccctgggtgctga

KEGG   Pongo abelii (Sumatran orangutan): 100442480
Entry
100442480         CDS       T01416                                 

Gene name
CSF3
Definition
(RefSeq) granulocyte colony-stimulating factor isoform X2
  KO
K05423  granulocyte colony-stimulating factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
pon04657  IL-17 signaling pathway
pon05144  Malaria
pon05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100442480 (CSF3)
   04151 PI3K-Akt signaling pathway
    100442480 (CSF3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100442480 (CSF3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100442480 (CSF3)
   04657 IL-17 signaling pathway
    100442480 (CSF3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100442480 (CSF3)
  09174 Infectious disease: parasitic
   05144 Malaria
    100442480 (CSF3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100442480 (CSF3)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  CSF and other factors
   100442480 (CSF3)
SSDB
Motif
Pfam: GCSF IL11 NAGLU IL6 Img2
Other DBs
NCBI-GeneID: 100442480
NCBI-ProteinID: XP_002827665
Ensembl: ENSPPYG00000008471
UniProt: A0A2J8WA76
LinkDB
Position
17
AA seq 204 aa
MAGPAAQSPMKLMALQLLLWHSALWTVQEATPLGPASSLPQSFLLKCLEQVRKIQGDGAA
LQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLTGCLSQLHSGLFLYQGLLQ
ALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGG
ILVASHLQSFLELAYRVLRHLAQP
NT seq 615 nt   +upstreamnt  +downstreamnt
atggctggacctgccgcccagagccccatgaagctgatggccctgcagctgctgctgtgg
cacagcgcactctggacagtgcaggaagccacccccctgggccctgccagctccctgccc
cagagcttcctgctcaagtgcttagagcaagtgaggaagatccagggcgatggcgcggca
ctccaggagaagctgtgtgccacctacaagctgtgccaccccgaggagctggtgctgctc
ggacactctctgggcatcccctgggctcccctgagcagctgccccagccaggccctgcag
ctgacaggctgcttgagccaactccatagcggcctcttcctctaccaggggctcctgcag
gccctggaagggatctcccctgagttgggccccaccttggacacactgcagctggacgtc
gccgactttgccaccaccatctggcagcagatggaagaactgggaatggcccctgccctg
cagcccacccagggtgccatgccagcctttgcctctgccttccagcgccgggccggaggc
atcctggttgcctcccatctgcagagcttcctggagctggcgtaccgcgttctacgccac
cttgcccagccctga

KEGG   Pongo abelii (Sumatran orangutan): 100446663
Entry
100446663         CDS       T01416                                 

Definition
(RefSeq) chorionic somatomammotropin hormone 2 isoform X2
  KO
K05438  growth hormone
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04080  Neuroactive ligand-receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
pon04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100446663
   04151 PI3K-Akt signaling pathway
    100446663
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100446663
   04060 Cytokine-cytokine receptor interaction
    100446663
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100446663
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100446663
Cytokines and growth factors [BR:pon04052]
 Cytokines
  CSF and other factors
   100446663
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 100446663
NCBI-ProteinID: XP_002827746
Ensembl: ENSPPYG00000008535
UniProt: H2NUF4
LinkDB
Position
17
AA seq 217 aa
MAAGSQTSLLLAFALLCLPWLQEAGAVQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEDA
YISKDQKYSFLHGSQTSFCFSDSIPTPSNMEETQQKSNSELLRLSLLLIESWLEPVRLLR
SIFTNNLVYDTSDSNDYHLLKDLEEGIQTLMGRLEDGSPRTGQILKQTYSKFDTNSHNHD
ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
NT seq 654 nt   +upstreamnt  +downstreamnt
atggctgcaggctcccagacgtccctgctcctggcttttgccctgctctgtctgccctgg
cttcaagaggctggtgccgtccaaaccgttcccttatccaggctttttgaccatgctatg
ctccaagcccatcgcgcccaccagctggccattgacacctaccaggagtttgaagacgcc
tatatctcaaaggaccagaagtattcattcctgcatggctcccagacctccttctgcttc
tcagactctattccgacaccctccaacatggaggaaacgcagcagaaatcgaactcagag
ctgctccgcctctccctgctgctcatcgagtcgtggctagagcccgtgcggctcctcagg
agtatcttcaccaacaacctggtgtatgacacctcggacagcaatgactatcacctccta
aaggacctagaggaaggaatccaaacgctgatggggaggctggaagacggcagcccccgg
actgggcagatcctcaagcagacctacagcaagtttgacacaaactcgcacaaccatgac
gcactgctcaagaactacgggctgctctactgcttcaggaaggacatggacaaggtcgag
acattcctgcgcatcgtgcagtgccgctctgtggagggcagctgtggcttctag

KEGG   Pongo abelii (Sumatran orangutan): 100447767
Entry
100447767         CDS       T01416                                 

Definition
(RefSeq) growth hormone variant isoform X1
  KO
K05438  growth hormone
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04080  Neuroactive ligand-receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
pon04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100447767
   04151 PI3K-Akt signaling pathway
    100447767
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100447767
   04060 Cytokine-cytokine receptor interaction
    100447767
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100447767
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100447767
Cytokines and growth factors [BR:pon04052]
 Cytokines
  CSF and other factors
   100447767
SSDB
Motif
Pfam: Hormone_1 HTH_5
Other DBs
NCBI-GeneID: 100447767
NCBI-ProteinID: XP_002827750
UniProt: A0A1B1R0V1 A0A0M6L0G5
LinkDB
Position
17
AA seq 217 aa
MAAGSQTSLLLAFGLLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEA
YILKEQKYSFLQNPQTSLCFSESIPTPSNRVKMQQKSNLELLRISVLLIQSWLEPVWFLR
SVFANSLVYGASDSNVYHHLKDLEEGIQTLMWRLEDGSPQTGQIFKQTYSKFDTKSHNDD
ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVKGSCGF
NT seq 654 nt   +upstreamnt  +downstreamnt
atggctgcaggctcccagacgtccctgctcctggcttttggcctgctctgcctgccctgg
cttcaagagggcagtgccttcccaaccattcccttatccaggctttttgacaatgctatg
ctccgcgcccatcgcctgcaccagctggcatttgacacctaccaggagtttgaagaagcc
tatatcctgaaggagcagaagtattcattcctgcagaacccccagacctccctctgcttc
tcagagtctattccgacaccttccaacagggtgaaaatgcagcagaaatccaacctagag
ctgctccgcatctctgtgctgctcatccagtcatggctggagcccgtgtggttcctcagg
agtgtcttcgccaacagcctggtgtatggcgcctcagacagcaatgtctatcaccaccta
aaggacctagaggaaggcatccaaacgctgatgtggaggctggaagatggcagcccccag
actgggcagatcttcaagcagacctacagcaagtttgacacaaaatcgcacaacgatgac
gcactgctcaagaactacgggctgctctactgcttcaggaaggacatggacaaggtcgag
acattcctgcgcatcgtgcagtgccgctctgtgaaaggcagctgtggcttctag

KEGG   Pongo abelii (Sumatran orangutan): 100448861
Entry
100448861         CDS       T01416                                 

Gene name
GH1
Definition
(RefSeq) somatotropin isoform X2
  KO
K05438  growth hormone
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04080  Neuroactive ligand-receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
pon04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100448861 (GH1)
   04151 PI3K-Akt signaling pathway
    100448861 (GH1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100448861 (GH1)
   04060 Cytokine-cytokine receptor interaction
    100448861 (GH1)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    100448861 (GH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100448861 (GH1)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  CSF and other factors
   100448861 (GH1)
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 100448861
NCBI-ProteinID: XP_002827754
UniProt: A0A0M6L0K8 A0A663DDR1
LinkDB
Position
17
AA seq 217 aa
MAAGSRTSLLLAFALLCLPWLQEGSAFPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEA
YIPKEQKYSFLQNPQTSLCFSESIPTPSNREETQQKSNLELLRISLLLIQSWLEPVQFLR
SVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIFKQTYSKFDTNSHNDD
ALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGF
NT seq 654 nt   +upstreamnt  +downstreamnt
atggctgcaggctcccggacgtccctgctcctggcttttgccctgctctgcctgccctgg
cttcaagagggcagtgccttcccaaccattcccttatccaggctttttgacaacgctatg
ctccgcgcccatcgcctgcaccagctggcctttgacacctaccaggagtttgaagaagcc
tatatcccaaaggaacagaagtattcattcctgcagaacccccagacctccctctgcttc
tcagagtctattccgacaccctccaacagggaggaaacgcaacagaaatccaacctagag
ctgctccgcatctctctgctgctcatccagtcgtggctggagcccgtgcagttcctcagg
agtgtctttgccaacagcctggtttatggcgcctcggacagcaacgtctatgacctccta
aaggacctagaggaaggcatccaaacgctaatggggaggctggaagatggcagcccccgg
actgggcagatcttcaagcagacctacagcaagtttgacacaaattcacacaacgatgac
gcactgctcaagaactacgggctgctctactgcttcaggaaggacatggacaaggtcgag
acattcctgcgcatcgtgcagtgccgctctgtggagggcagctgtggcttctag

KEGG   Pongo abelii (Sumatran orangutan): 100450466
Entry
100450466         CDS       T01416                                 

Gene name
PRL
Definition
(RefSeq) prolactin
  KO
K05439  prolactin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04080  Neuroactive ligand-receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
pon04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100450466 (PRL)
   04151 PI3K-Akt signaling pathway
    100450466 (PRL)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100450466 (PRL)
   04060 Cytokine-cytokine receptor interaction
    100450466 (PRL)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100450466 (PRL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100450466 (PRL)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  CSF and other factors
   100450466 (PRL)
SSDB
Motif
Pfam: Hormone_1
Other DBs
NCBI-GeneID: 100450466
NCBI-ProteinID: XP_002816520
Ensembl: ENSPPYG00000016273
UniProt: H2PI19 A0A6D2X691
LinkDB
Position
6
AA seq 227 aa
MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNL
SSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQINQKDFLSLIVSILRSWN
EPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSG
LSSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC
NT seq 684 nt   +upstreamnt  +downstreamnt
atgaacatcaaaggatcgccatggaaagggtccctcctgctgctgctggtgtcaaacctg
ctcctgtgccagagcgtggcccccttgcccatctgtcccggcggggctgccagatgccag
gtgacccttcgagacctgtttgaccgcgcagtcgtcctgtcccactacatccataacctc
tcctcagaaatgttcagcgaatttgataaacggtatacccatggccgggggttcatcacc
aaggccatcaacagctgccacacttcttcccttgccacccccgaagacaaggagcaagcc
caacagatcaatcaaaaagactttctgagcctgatagtcagcatattgcgatcctggaat
gagcctctgtatcatctagtcacggaagtacgtggtatgcaagaagccccagaggctatc
ctatccaaagccgtagagattgaggagcaaaccaaacggcttctagagggcatggagctg
atagtcagccaggttcatcctgaaaccaaagaaaatgagatctaccctgtctggtcggga
ctttcatccctgcagatggctgatgaagagtctcgcctttctgcttattataacctgctc
cactgcctacgcagggattcacataaaatcgacaattatctcaagctcctgaagtgccga
atcatccacaacaacaactgctaa

KEGG   Pongo abelii (Sumatran orangutan): 100452053
Entry
100452053         CDS       T01416                                 

Gene name
THPO
Definition
(RefSeq) thrombopoietin isoform X1
  KO
K06854  thrombopoietin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100452053 (THPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100452053 (THPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100452053 (THPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100452053 (THPO)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  CSF and other factors
   100452053 (THPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 100452053
NCBI-ProteinID: XP_024100339
LinkDB
Position
3
AA seq 493 aa
MDSPIQIFSVVCVGGGVDPGPGRGSREEKASLPGAFTSVWWLPSLIGQKWPRQAYDLLLW
RGCAPPPHVFLPNCSPEGCLLCTWVLEPFSTRIDSSSLARLCPTLLCPEVQEPKPPPWPQ
EGFRGEAPNREPRQPDTPARMELTELLLVVMLLLTARLTLSSPAPPACDLRVLSKLLRDS
HVLHSRLSQCPEVHPLPAPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEAVMAARG
QLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKV
RFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLK
RQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGASDISPGTSD
TGSLPPNLQPGYSSSPTHPPTGQYTLFPLPPTLLTPVVQLHPLLHDPSAPTPTPTSPLLN
TSYTHSQNLSQEG
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggattcccccatccaaatcttctccgtggtgtgtgtgggtggaggagtggaccctggt
ccaggcaggggctccagggaagagaaggcgtcacttccgggggccttcaccagtgtctgg
tggctcccttctctgattgggcagaagtggcccaggcaggcgtatgacctgctgctgtgg
aggggctgtgccccaccgccacatgtcttcctacccaactgctccccagagggctgcctg
ctgtgcacttgggtcctggagcccttctccacccggatagattcctcatccttggcccgc
ctttgccccaccctactctgcccagaagtgcaagagcccaagccgcctccatggccccag
gaaggattcaggggagaggccccaaacagggagccacgccagccagacaccccggccaga
atggagctgactgaattgctcctcgtggtaatgcttctcctaactgcaaggctaacgctg
tccagcccggctcctcctgcttgtgacctccgagtcctcagtaaactgcttcgtgactcc
catgtccttcacagcagactgagccagtgcccagaggttcaccctttgcctgcacctgtc
ctgctgcctgctgtggactttagcttgggagaatggaaaacccagatggaggaaaccaag
gcacaggacattctgggagcagtgacccttctgctggaggcagtgatggcagcacgggga
caactgggacccacttgcctctcatccctcctggggcagctttctggacaggtccgtctc
ctccttggggccctgcagagcctccttggaacccagcttcctccacagggcaggaccaca
gctcacaaggatcccaatgccatcttcctgagcttccaacacctgctccgaggaaaggtg
cgtttcctgatgcttgtaggagggtccaccctctgcgtcaggcgggccccacccaccaca
gctgtccccagcagaacctctctagtcctcacactgaacgagctcccaaacaggacttct
ggattgttggagacaaacttcactgcctcagccagaactactggctctgggcttctgaag
cggcagcagggattcagagccaagattcctggtctgctgaaccaaacctccaggtccctg
gaccaaatccctggatacctgaacaggatacacgaactcttgaatggaactcgtggactc
tttcctggaccctcacgcaggaccctaggagcctcggacatttccccaggaacatcagac
acaggctccctgccacccaacctccagcctggatattcttcttccccaacccatccccct
actggacagtatacactcttccctcttccacccaccttgctcacccctgtggtccagctc
caccccctgcttcatgacccttctgctccaacgcccacccctaccagccctcttctaaac
acatcctacacccactcccagaatctgtctcaggaagggtaa

KEGG   Pongo abelii (Sumatran orangutan): 100459890
Entry
100459890         CDS       T01416                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin isoform X1
  KO
K05437  erythropoietin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04066  HIF-1 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100459890 (EPO)
   04066 HIF-1 signaling pathway
    100459890 (EPO)
   04151 PI3K-Akt signaling pathway
    100459890 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100459890 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100459890 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100459890 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100459890 (EPO)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  CSF and other factors
   100459890 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 100459890
NCBI-ProteinID: XP_024105759
LinkDB
Position
7
AA seq 193 aa
MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENVTTGCAEHC
SLSENITVPDTKVNFYAWKRMEVGQQALEVWQGLALLSEAVLRGQALLVNSSQPWEPLQL
HVDKAVSGLRSLTTLLRALGAQKEANSPPDAALAAPLRTITADTFRKFFRVYSNFLRGKL
KLYTEEACRTGDR
NT seq 582 nt   +upstreamnt  +downstreamnt
atgggggtgcacgaatgtcctgcctggctgtggcttctcctatccctgctgtcgctccct
ctgggcctcccagtcctgggcgccccaccacgcctcatctgtgacagccgagtcctggag
aggtacctcttggaggccaaggaggccgagaatgtcacgacgggctgtgccgaacactgc
agcttgagtgagaatatcaccgtcccagacaccaaagttaacttctatgcctggaagagg
atggaggtcgggcagcaggccttagaagtctggcagggcctggccctgctctcggaagct
gtcctgcggggccaggccctgttggtcaactcttcccagccgtgggagcccctgcagctg
cacgtggataaagctgtcagtggccttcgcagcctcaccactctgcttcgggcgctggga
gcccagaaggaagccaactcccctccagatgcggccttggctgctccactccgaacaatc
actgctgacactttccgcaaattcttccgagtctactccaatttcctccggggaaagctg
aagctgtacacagaggaggcctgcaggacaggggacagatga

KEGG   Pongo abelii (Sumatran orangutan): 103891808
Entry
103891808         CDS       T01416                                 

Gene name
CNTF
Definition
(RefSeq) ciliary neurotrophic factor
  KO
K05420  ciliary neurotrophic factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103891808 (CNTF)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103891808 (CNTF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    103891808 (CNTF)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  CSF and other factors
   103891808 (CNTF)
SSDB
Motif
Pfam: CNTF DUF3719
Other DBs
NCBI-GeneID: 103891808
NCBI-ProteinID: XP_009244600
Ensembl: ENSPPYG00000029766
UniProt: K7EVU6
LinkDB
Position
11
AA seq 200 aa
MAFTEHSPLTPHRRDLCSRSIWLARKIHSDLTALMESYVKHQGLNKNINLDSADGVPVAS
TDRWRELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQTIHTLLLQVAAFA
YQIEELMILLEYKIPRNEADGMPISVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVIS
SHQTGIPARGSHYIANNKKM
NT seq 603 nt   +upstreamnt  +downstreamnt
atggctttcacagagcattcaccgctgacccctcaccgtcgggacctctgtagccgctct
atctggctagcaaggaagattcattcagacctgactgctcttatggaatcttatgtgaaa
catcagggcctgaacaagaacatcaacctggactctgcggatggggtgccagtggcaagc
actgatcggtggcgtgagctgaccgaggcagagcgactccaagagaaccttcaagcttat
cgtaccttccatgttttgttggccaggcttttagaagaccagcaggtgcattttacccca
accgaaggtgacttccatcaaactatacacacccttcttctccaagtcgctgcctttgca
taccagatagaggagttaatgatactcctggaatacaagatcccccgcaatgaggctgat
gggatgcctattagtgttggagatggtggtctctttgagaagaagctatggggcctaaag
gtgctgcaggagctttcacagtggacagtaaggtccatccatgaccttcgtgtcatttct
tctcatcagactgggatcccagcacgtgggagccattatattgctaacaacaagaaaatg
tag

KEGG   Pongo abelii (Sumatran orangutan): 103892869
Entry
103892869         CDS       T01416                                 

Definition
(RefSeq) chorionic somatomammotropin hormone 2-like isoform X1
  KO
K05438  growth hormone
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04080  Neuroactive ligand-receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
pon04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103892869
   04151 PI3K-Akt signaling pathway
    103892869
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103892869
   04060 Cytokine-cytokine receptor interaction
    103892869
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    103892869
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    103892869
Cytokines and growth factors [BR:pon04052]
 Cytokines
  CSF and other factors
   103892869
SSDB
Motif
Pfam: Hormone_1 Calcyon
Other DBs
NCBI-GeneID: 103892869
NCBI-ProteinID: XP_024090235
LinkDB
Position
17
AA seq 193 aa
MAAGSQTSLLLAFALLCLPWLQEAGAVQTVPFSRPLDHAMLQAHCAHQLAIDTYQEFEEA
YIPKDQKYSFLHDSQTSSCFSDSIPTPSNMEETQQKSNSELLHISLLLIESWLEPVWFLR
NIFTNNLVFDTSDSDDYHLLKDLEKGIQTLIGRLEDGSPRTGQIFKQTYSKFDTNSHNHD
ALLKNYGLLHCFR
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgcaggctcccagacgtccctgctcctggcttttgccctgctctgcctgccctgg
cttcaagaggctggtgccgtccaaaccgttcccttttccaggcctcttgaccatgctatg
ctccaagcccattgcgcgcaccagctggccattgacacctaccaggagtttgaagaagcc
tatatcccaaaggaccagaagtattcattcctgcatgactcccagacctcctcctgcttc
tcagactctattccgacaccctccaacatggaggaaacgcagcagaaatcgaactcagag
ctgctccacatctccctgctgctcatcgagtcgtggctggagcccgtgtggttcctcagg
aatatcttcaccaacaacctggtgtttgacacctcggacagcgatgactatcacctccta
aaggacttagagaaaggcatccaaacgctgattgggaggctggaagacggcagtccccgg
actgggcagatcttcaaacagacctacagcaagtttgacacaaactcacacaaccatgac
gctctgctcaagaactacgggctgctccactgcttcaggtag

DBGET integrated database retrieval system