KEGG   Pongo abelii (Sumatran orangutan): 100440613
Entry
100440613         CDS       T01416                                 

Gene name
CHPT1
Definition
(RefSeq) cholinephosphotransferase 1
  KO
K00994  diacylglycerol cholinephosphotransferase [EC:2.7.8.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00440  Phosphonate and phosphinate metabolism
pon00564  Glycerophospholipid metabolism
pon00565  Ether lipid metabolism
pon01100  Metabolic pathways
pon05231  Choline metabolism in cancer
Module
pon_M00090  Phosphatidylcholine (PC) biosynthesis, choline => PC
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    100440613 (CHPT1)
   00565 Ether lipid metabolism
    100440613 (CHPT1)
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    100440613 (CHPT1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100440613 (CHPT1)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.2  diacylglycerol cholinephosphotransferase
     100440613 (CHPT1)
SSDB
Motif
Pfam: CDP-OH_P_transf
Other DBs
NCBI-GeneID: 100440613
NCBI-ProteinID: XP_024112354
LinkDB
Position
12
AA seq 406 aa
MAAGAGARSAPRWLRALSEPLSAAQLRRLEEHRYSAAGVSLLEPPLQLYWTWLLQWIPLW
MAPNSITLLGLAVNVVTTLVLISYCPTATEEAPYWTYLLCALGLFIYQSLDAIDGKQARR
TNSCSPLGELFDHGCDSLSTVFMAVGASIAARLGTHPDWFFFCSFIGMFVFYCAHWQTYV
SGVLRFGKVDVTEIQIALVIVFVLSAFGGATMWDYTIPILEIKLKILPVLGFLGGVIFSC
SNYFHVILHGGVGKNGSTIAGTSVLSPGLHIGLIIILAIMIYKKSATDVFEKHPCLYTLM
FGCVFAKVSQKLVIAHMTKSELYLQDTVFLGPGLLFLDQYFNNFIDEYVVLWIAMVISSF
DMVIYFSALCLQISRHLHLNIFKTACHQAPEQVQVLSSKSHQNNMD
NT seq 1221 nt   +upstreamnt  +downstreamnt
atggcggcaggcgccggggccaggtccgcgccgcgctggctgagggcgctgagcgagccg
ctgagcgcggcgcagctgcggcgactggaggagcaccgctacagcgcggcgggcgtctcg
ctgctcgagccgccgctgcagctctactggacctggctgctccagtggatcccgctctgg
atggcccccaactccatcaccctgctggggctcgccgtcaacgtggtcaccacgctcgtg
ctcatctcctactgtcccacggccaccgaggaggcaccatactggacataccttttatgt
gcactgggactttttatttaccaatcactggatgccattgatgggaaacaagccagaaga
acaaactcttgttctcctttaggggagctctttgaccatggttgtgactctctttccaca
gtatttatggcagtgggagcttcaattgccgctcgcttaggaactcatcctgattggttt
tttttctgctcttttattgggatgtttgtgttttattgcgctcattggcagacttatgtt
tcaggcgtgttgagatttggaaaagtggatgtaactgaaattcagatagctttagtgatt
gtctttgtattatctgcatttggaggagcaacaatgtgggactatacgattcctattcta
gaaataaaattgaagatccttccagttcttggatttctaggtggagtaatattttcctgt
tcaaattatttccatgttatcctccatggtggtgttggcaagaatggatccactatagca
ggcaccagtgtcttgtcacctggactccacataggactaattattatactggcaataatg
atctataaaaagtcagcaactgatgtgtttgaaaagcatccttgtctttataccctaatg
tttggatgtgtctttgctaaagtctcacaaaaattagtgatagctcacatgaccaaaagt
gaactgtatcttcaagacactgtctttttggggccaggtcttttgtttttagaccagtac
tttaataattttatagacgaatatgttgttctatggatagcaatggtgatttcttcattt
gatatggtgatatactttagtgctttgtgcctgcaaatttcaagacaccttcatctaaat
atattcaagactgcatgtcatcaagcacctgaacaggttcaagttctttcttcaaagagt
catcagaataacatggattga

DBGET integrated database retrieval system