KEGG   Pongo abelii (Sumatran orangutan): 100440650
Entry
100440650         CDS       T01416                                 

Gene name
PIAS4
Definition
(RefSeq) E3 SUMO-protein ligase PIAS4
  KO
K16065  E3 SUMO-protein ligase PIAS4 [EC:2.3.2.27]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04064  NF-kappa B signaling pathway
pon04120  Ubiquitin mediated proteolysis
pon04630  JAK-STAT signaling pathway
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100440650 (PIAS4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100440650 (PIAS4)
   04064 NF-kappa B signaling pathway
    100440650 (PIAS4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100440650 (PIAS4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pon04121]
    100440650 (PIAS4)
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100440650 (PIAS4)
Ubiquitin system [BR:pon04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   100440650 (PIAS4)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse SAP Sporozoite_P67
Other DBs
NCBI-GeneID: 100440650
NCBI-ProteinID: XP_024093750
Ensembl: ENSPPYG00000009394
LinkDB
Position
19
AA seq 510 aa
MAAELVEAKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKKIKE
LYETRYAKKNSEPAPQPHRPLDPLTMHSTYDRAGAVPRTPLAGPNIDYPVLYGKYLNGLG
RLPAKTLKPEVRLVKLPFFNMLDELLKPTELVPQNNEKLQESPCIFALTPRQVELIRNSR
ELQPGVKAVQVVLRICYSDTSCPQEDQYPPNIAVKVNHSYCSVPGYYPSNKPGVEPKRPC
RPINLTHLMYLSSATNRITVTWGNYGKSYSVALYLVRQLTSSELLQRLKTIGVKHPELCK
ALVKEKLRLDPDSEIATTGVRVSLICPLVKMRLSVPCRAETCAHLQCFDAVFYLQMNEKK
PTWMCPVCDKPAPYDQLIIDGLLSKILSECEDADEIEYLVDGSWCPIRAEKERSCSPQGA
ILVLGPSDASGLLPAPSVNGSGALGSTGGGGPVGSVENGKPGADVVDLTLDSSSSSEDEE
EEEEEEEDEDEEGPRPKRRCPFQKGLVPAC
NT seq 1533 nt   +upstreamnt  +downstreamnt
atggcggcggagctggtggaggccaaaaacatggtgatgagttttcgagtctccgacctt
cagatgctcctgggtttcgtgggccggagtaagagcggactgaagcacgagctagtcacc
agggccctccagctggtgcagtttgactgtagccctgagctgttcaagaagatcaaggag
ctgtacgagacccgctacgccaagaagaactcggagcctgccccacagccacatcggccc
ctggaccccctgaccatgcactccacctacgaccgggccggcgcggtgcccaggactcca
ctggcaggccccaatattgactaccccgtgctctacggaaagtacttaaacggactggga
cggttgcccgccaagaccctcaagccagaagtccgcctggtgaagctgccgttctttaat
atgctggacgagctgctgaagcccaccgaattagtcccacagaacaacgagaagcttcag
gagagcccatgcatcttcgcattgacgccaagacaggtggagttgatccggaactccagg
gaactgcagcccggagttaaagccgtgcaggtcgtcctgagaatctgttactcagatacc
agctgccctcaggaggaccagtacccgcccaacatcgctgtgaaggtcaaccacagctac
tgctcagtcccgggctactacccctccaataagcccggggtggagcccaagaggccgtgc
cgccccatcaacctcacccacctcatgtacctgtcctcggccaccaaccgcatcaccgtc
acctgggggaactatggcaagagctactcggtggccctgtacctggtacggcagctgacc
tcgtcggagctgctgcagaggctgaagaccattggggtgaagcacccggagctgtgcaag
gcgctggtcaaggagaagctgcgccttgatcctgacagcgagatcgccaccaccggtgtg
cgagtgtccctcatctgcccgctggtgaaaatgcggctctctgtgccctgccgggcagag
acctgcgcccacttgcagtgcttcgacgccgtcttctacctgcagatgaacgagaagaag
cccacctggatgtgccccgtgtgtgacaagccagccccctacgaccagctcatcattgat
gggctcctctcgaagatcctgagcgagtgtgaggacgctgacgagatcgagtacctggtg
gacggctcgtggtgcccgatccgcgccgaaaaggagcgcagctgcagcccgcagggcgcc
atcctcgtgctgggcccctcggacgccagtgggctcctgcccgcccccagcgtcaacggg
agcggtgccctgggcagcacaggtggcggcggccctgtgggcagcgtggagaatgggaag
ccgggcgccgatgtggtggacctcacgctggacagctcatcatcctcggaggatgaggag
gaggaggaagaggaggaggaagacgaggacgaagagggaccccggcccaagcgccgctgc
cccttccagaagggcctggtgccggcctgctga

KEGG   Pongo abelii (Sumatran orangutan): 100450652
Entry
100450652         CDS       T01416                                 

Gene name
PIAS1
Definition
(RefSeq) E3 SUMO-protein ligase PIAS1 isoform X2
  KO
K04706  E3 SUMO-protein ligase PIAS1 [EC:2.3.2.-]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04120  Ubiquitin mediated proteolysis
pon04630  JAK-STAT signaling pathway
pon05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100450652 (PIAS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100450652 (PIAS1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    100450652 (PIAS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pon04121]
    100450652 (PIAS1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100450652 (PIAS1)
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     100450652 (PIAS1)
Ubiquitin system [BR:pon04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   100450652 (PIAS1)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septin associated proteins
    100450652 (PIAS1)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 100450652
NCBI-ProteinID: XP_002825636
Ensembl: ENSPPYG00000006589
UniProt: A0A2J8UCA9
LinkDB
Position
15
AA seq 651 aa
MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
YRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHEL
ELPHLTSALHPVHPDIKLQKLPFYDLLDELIKPTSLASDNSQRFRETCFAFALTPQQVQQ
ISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNYSMAVYLVKQLSSTVLLQRLRAK
GIRNPDHSRALIKEKLTADPDSEIATTSLRVSLLCPLGKMRLTIPCRALTCSHLQCFDAT
LYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRT
CPSLSPTSPLNNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDL
QGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTS
LPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISLD
NT seq 1956 nt   +upstreamnt  +downstreamnt
atggcggacagtgcggaactaaagcaaatggttatgagccttagagtttctgaactccaa
gtactgttgggctacgctgggagaaacaagcacggacgcaaacacgaacttctcacaaaa
gccctgcatttgctaaaggctggctgtagtcctgctgtacaaatgaaaattaaggaactc
tataggcggcggttcccgcagaaaatcatgacacctgcagacttgtccatccccaacgta
cattcaagtcctatgccagcaactttgtctccatctaccattccacaactcacttacgat
ggtcaccctgcatcatcgccattacttcctgtttctcttctgggacctaaacatgaactg
gaactcccacatcttacatcagctcttcacccagtccatccggatataaaacttcaaaaa
ttaccattttatgatttactggatgaactgataaaacccaccagtctagcatcagacaac
agtcagcgctttcgagaaacctgttttgcatttgccttgacaccacaacaagtgcagcaa
atcagtagttccatggatatttctgggaccaaatgtgacttcacagtacaggtccagtta
aggttttgtttatcagaaaccagttgcccacaagaagatcacttcccacccaatctttgt
gtgaaagtgaatacaaaaccttgcagccttccaggttaccttccacctacaaaaaatggc
gtggaaccaaagcgacccagccgaccaattaatatcacctcacttgtccgactgtccaca
acagtaccaaacacgattgttgtttcttggactgcagaaattggaagaaactattccatg
gcagtgtatcttgtaaaacagttgtcctcaacagttcttcttcagaggttacgagcaaag
ggaataaggaatccggatcattctagagctttaattaaagagaagttgactgcagatcca
gacagtgaaatagctacaaccagcctaagggtttctctactatgtccacttggtaaaatg
cggctgacaattccgtgtcgggcccttacatgttctcatctacaatgttttgacgcaact
ctttacattcagatgaatgagaaaaaaccaacctgggtttgtcctgtctgtgataagaag
gctccatatgaacaccttattattgatggcttgtttatggaaatcctaaagtactgtaca
gactgtgatgaaatacagtttaaagaggatggcacttgggcaccgatgagatcgaaaaag
gaagtacaagaagtttctgcctcttacaatggagtcgatggatgcttgagctccacattg
gagcatcaggtagcgtctcaccaccagtcctcaaataaaaacaagaaagtagaagtgatt
gacctaaccatagacagttcatctgatgaagaggaagaagagccatctgccaagaggacc
tgtccttccctgtctcccacatcaccactaaataataaaggcattttaagtcttccacat
caagcatctccagtatcccgcaccccaagccttcctgctgtagacacaagctacattaat
acctccctcatccaagactataggcatcctttccacatgacacccatgccttacgactta
caaggattagatttctttcctttcttatcaggagacaatcagcattacaacacctccttg
cttgccgctgcagcagcagcagtttcagatgatcaagacctcctgcactcgtctcggttt
ttcccgtatacctcctcacagatgtttcttgatcagttaagtgcaggaggcagtacttct
ctgccaaccaccaatggaagcagtagtggcagtaacagcagcctggtttcttccaacagc
ctaagggagagccatagccacactgtcacaaacaggagcagcacggacacggcatccatc
tttggcatcataccagacattatttcattggactga

KEGG   Pongo abelii (Sumatran orangutan): 100454767
Entry
100454767         CDS       T01416                                 

Gene name
PIAS2
Definition
(RefSeq) E3 SUMO-protein ligase PIAS2 isoform X1
  KO
K16063  E3 SUMO-protein ligase PIAS2 [EC:2.3.2.-]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04120  Ubiquitin mediated proteolysis
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100454767 (PIAS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100454767 (PIAS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pon04121]
    100454767 (PIAS2)
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     100454767 (PIAS2)
Ubiquitin system [BR:pon04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   100454767 (PIAS2)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse PHD
Other DBs
NCBI-GeneID: 100454767
NCBI-ProteinID: XP_024091920
LinkDB
Position
18
AA seq 622 aa
MADFEELRNMVSSFRVSELQVLLGFAGRNKSGRKHDLLMRALHLLKSGCSPAVQIKIREL
YRRRYPRTLEGLSDLSTIKSSVFSLDGSSSPVEPDLAVAGIHSLPSTSVTPHSPSSPVGS
VLLQDTKPTFEMQQPSPPIPPVHPDVQLKNLPFYDVLDVLIKPTSLVQSSIQRFQEKFFI
FALTPQQVREICISRDFLPGGRRDYTVQVQLRLCLAETSCPQEDNYPNSLCIKVNGKLFP
LPGYAPPPKNGIEQKRPGRPLNITSLVRLSSAVPNQISISWASEIGKNYSMSVYLVRQLT
SAMLLQRLKMKGIRNPDHSRALIKEKLTADPDSEIATTSLRVSLMCPLGKMRLTIPCRAV
TCTHLQCFDAALYLQMNEKKPTWICPVCDKKAAYESLILDGLFMEILNDCSDVDEIKFQE
DGSWCPMRPKKEAMKVSSQPCTKIESSSVLSKPCSVTVASEASKKKVDVIDLTIESSSDE
EEDPPAKRKCIFMSETQSSPTKGVLMYQPSSVRVPSVTSVDPAAIPPSLTDYSVPFHHTP
ISSVSSDLPGLDFLSLIPVDPQQYCPPMFLDSLTSPLTASSTSVTTTSSHESSTHVSSSS
SRSETGVITSSGSNIPDIISLD
NT seq 1869 nt   +upstreamnt  +downstreamnt
atggcggatttcgaagagttgaggaatatggtttctagttttagggtttctgaactacaa
gtattactaggctttgctggacggaataaaagtggacgcaagcatgacctcctgatgagg
gcgctgcatttattgaagagtggctgcagccctgcggttcagattaaaatccgagaattg
tatagacgccgatatccacgaactcttgaaggactttctgatttatccacaatcaaatca
tcggttttcagtttggatggtagctcatcacctgtagaacctgacttggccgtggctgga
atccactcgttgccttccacttcagttacacctcactcaccatcctctcctgttggttct
gtgctgcttcaagatactaagcccacatttgagatgcagcaaccatctcccccaattcct
cctgtccatcctgatgtgcagttaaaaaatctgcccttttatgatgtccttgatgttctc
atcaagcccacgagtttagttcaaagcagtattcagcgatttcaagagaagttttttatt
tttgctttgacacctcaacaagttagagagatatgcatatccagggattttttgccaggt
ggtaggagagattatacagtccaagttcagttgagactttgcctggcagagacaagttgc
cctcaagaagataactatccaaatagtctatgtataaaagtaaatgggaagctatttcct
ttacctggctatgcaccaccgcctaaaaatgggattgaacagaagcgccccggacgcccc
ttgaatattacatctttagttaggttatcttcagctgtgccaaaccaaatttccatttct
tgggcatcagaaattgggaagaattactctatgtctgtatatcttgtacggcagcttaca
tcagccatgttattacagagattaaaaatgaaaggtattagaaaccctgatcattccaga
gcactaattaaagaaaaacttaccgcagatcctgatagtgaaattgctacaactagcctt
cgggtatccttgatgtgccctttaggaaaaatgaggctgacaatcccatgccgtgcagtg
acttgtacacatctacagtgttttgatgctgccctttatctacaaatgaatgagaagaag
cccacctggatttgtcctgtgtgtgacaaaaaagctgcctatgaaagtctaatattagat
gggctttttatggaaattctcaatgactgttctgatgtggatgagatcaaattccaagaa
gatggttcttggtgtccaatgagaccgaagaaagaagctatgaaagtatccagccaaccg
tgtacaaaaatagaaagttcaagcgtcctcagtaagccttgttcagtgactgtagccagt
gaggcaagcaagaagaaagtagatgttattgatcttacaatagaaagctcttctgacgaa
gaggaagaccctcctgccaaaaggaaatgcatctttatgtcagaaacacaaagcagccca
accaaaggggttctcatgtatcagccatcttctgtaagggtgcccagtgtgacttcggtt
gatcctgctgctattccgccttcattaacagactactcagtaccattccaccatacgcca
atatcaagcgtgtcatcagatttgccaggtttggattttctttcccttattccagttgat
ccccagcagtactgtcctcctatgtttttggatagtctcacctcacccttaacagcaagc
agtacgtctgtcaccaccaccagctcccatgaaagcagtactcatgttagttcatccagc
agcaggagtgagacaggggtcataaccagcagtggaagtaacattcctgacatcatctca
ttggactaa

KEGG   Pongo abelii (Sumatran orangutan): 100461795
Entry
100461795         CDS       T01416                                 

Gene name
PIAS3
Definition
(RefSeq) E3 SUMO-protein ligase PIAS3 isoform X1
  KO
K16064  E3 SUMO-protein ligase PIAS3 [EC:2.3.2.-]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04120  Ubiquitin mediated proteolysis
pon04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100461795 (PIAS3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100461795 (PIAS3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pon04121]
    100461795 (PIAS3)
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.-  
     100461795 (PIAS3)
Ubiquitin system [BR:pon04121]
 Ubiquitin ligases (E3)
  UBL E3 ligases
   100461795 (PIAS3)
SSDB
Motif
Pfam: PINIT zf-MIZ zf-Nse
Other DBs
NCBI-GeneID: 100461795
NCBI-ProteinID: XP_002810367
Ensembl: ENSPPYG00000000934
UniProt: A0A2J8SQ82
LinkDB
Position
1
AA seq 628 aa
MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKEL
YRRRFPRKTLGPSDLSLLSLPPGTSPVGSPGPLAPIPPTLLAPGTLLGPKREVDMHPPLP
QPVHPDVTMKPLPFYEVYGELIRPTTLASTSSQRFEEAHFTFALTPQQVQQILTSREVLP
GAKCDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSR
PINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHS
RALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEK
KPTWTCPVCDKKAPYESLIIDGLFMEILSSCSDCDEIQFMEDGSWCPMKPKKEASEVCPP
PGYGLDGLQYSPVQEGNPSENKKKVEVIDLTIESSSDEEDLPPTKKHCSVTSAAIPALPG
SKGVLTSGHQPSSVLRSPAMGTLGGDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQ
HYGPSVITSLDEQDALGHFFQYRGTPSHFLGPLAPTLGSSHRSATPAPPPGRVSSIVAPG
GALREGHGGPLPSGPSLTGCRSDIISLD
NT seq 1887 nt   +upstreamnt  +downstreamnt
atggcggagctgggcgaattaaagcacatggtgatgagtttccgggtgtctgagcttcag
gtgcttcttggctttgctggccggaataagagtggacggaagcacgagctcctggccaag
gctctgcacctcctgaagtccagctgtgcccctagtgtccagatgaagatcaaagagctt
taccgacgacgctttccccggaagaccctggggccctctgatctctcccttctctctttg
ccccctggcacctctcctgtaggctcccctggtcctctagctcccattcccccaaccctg
ttggcccctggcaccctgctgggccccaagcgtgaggtggacatgcacccccctctgccc
cagcctgtgcaccctgatgtcaccatgaaaccattgcccttctatgaagtctatggggag
ctcatccggcccaccacccttgcatccacttctagccagcggtttgaggaagcgcacttt
acctttgccctcacaccccagcaagtgcagcagattcttacatccagagaggttctgcca
ggagccaaatgtgattataccatacaggtgcagctaaggttctgtctctgtgagaccagc
tgcccccaggaagattattttccccccaacctctttgtcaaggtcaatgggaaactgtgc
cccctgccgggttaccttcccccaaccaagaatggggccgagcccaagaggcccagccgc
cccatcaacatcacacccctggctcgactctcagccactgttcccaacaccattgtggtc
aattggtcatctgagtttggacggaattactccttgtctgtgtacctggtgaggcagttg
actgcaggaacccttctacaaaaactcagagcaaagggtatccggaacccagaccactcg
cgggcactgatcaaggagaaattgactgctgatcctgacagtgaggtggccactacgagt
ctccgggtgtcactcatgtgcccgctagggaagatgcgcctgactgtcccttgtcgtgcc
ctcacctgtgcccacctgcagagcttcgatgctgccctttatctacagatgaatgagaag
aagcctacgtggacatgtcctgtgtgtgacaagaaggctccctatgaatctcttatcatt
gatggtttatttatggagattcttagttcctgttcagattgtgatgagatccaattcatg
gaagatggatcctggtgcccaatgaaacccaagaaggaggcatctgaggtttgccccccg
ccagggtatgggctggatggcctccagtacagcccagtccaggagggaaatccatcagag
aataagaagaaggtcgaagttattgacttgacaatagaaagctcatcagatgaggaggat
ctgccccctaccaagaagcactgttctgtcacctcagctgccatcccggccctacctgga
agcaaaggagtcctgacgtctggccaccagccatcctcggtgctcaggagccctgctatg
ggcacgttgggtggggatttcctgtccagtctcccactacatgagtacccacctgccttc
ccactgggagccgacatccaaggtttagatttattttcatttcttcagacagagagtcag
cactatggcccctccgtcatcacctcactagatgaacaggatgcccttggccactttttc
cagtaccgagggaccccttctcactttctgggcccactggcccccacgttggggagttcc
caccgcagcgccactccggcaccccctcctggccgtgtcagcagcattgtggcccctggg
ggggccttgagggaggggcatggaggacccctgccctcaggtccctctttgactggctgt
cggtcagacatcatttccctggactga

DBGET integrated database retrieval system