KEGG   Pongo abelii (Sumatran orangutan): 100440658
Entry
100440658         CDS       T01416                                 

Gene name
SLC7A10
Definition
(RefSeq) asc-type amino acid transporter 1
  KO
K13782  solute carrier family 7 (D/L-type amino acid transporter), member 10
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
KEGG Orthology (KO) [BR:pon00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100440658 (SLC7A10)
Transporters [BR:pon02000]
 Solute carrier family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   100440658 (SLC7A10)
SSDB
Motif
Pfam: AA_permease_2 AA_permease
Other DBs
NCBI-GeneID: 100440658
NCBI-ProteinID: XP_009230667
Ensembl: ENSPPYG00000009827
LinkDB
Position
19
AA seq 393 aa
MYPTSLAVISMTFSNYVLQPVFPNCIPPAAASRVLSMACLMLLTWVNSSSVRWATRIQDM
FTGGKLLALSLIIGVGLLQIFQGHFEELRPSNAFAFWMTPSVGHLALAFLQGSFAFSGWN
FLNYVTEEMVDARKNLPRAIFISIPLVTFVYTFTNIAYFTAMSPQELLSSNAVAVTFGEK
LLGYFSWVMPVSVALSTFGGINGYLFTYSRLCFSGAREGHLPSLLAMIHVRHCTPIPALL
VCCGATAIIMLVGDTYTLINYVSFINYLCYGVTILGLLLLRWRRPALHRPIKVNLLIPVA
YLVFWAFLLVFSFISEPMVCGVGVIIILTGVPIFFLGVFWRSKPKCVHRLTESMTRWGQE
LCFVVYPQDAPEEENGPCPPSLLPATDKPSKTQ
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgtaccccaccagccttgctgtcatctccatgacattctccaactacgtgctgcagcct
gtgttccccaactgcatcccccctgccgcagcctcccgggtgctgtccatggcctgcctg
atgctcctgacatgggtgaacagctccagcgtgcgctgggccacacgcatccaggacatg
ttcacaggcgggaagctgctggccttgtccctcatcatcggcgtgggccttctccagatc
ttccaaggacacttcgaggagctgaggcccagcaatgcctttgctttctggatgacaccc
tccgtgggacacctggccctggccttcctccagggctcctttgccttcagtggctggaac
ttcctcaactatgtcaccgaggagatggttgatgcccgaaagaacctacctcgcgccatc
ttcatctccatcccactggtgaccttcgtgtacaccttcaccaacattgcctacttcacg
gccatgtccccccaggagctgctctcctccaatgcggtggctgtgaccttcggggagaag
ctgctgggctacttttcttgggtcatgcccgtctccgtggctctgtcaaccttcggaggg
atcaatggctacctgttcacctactccaggctgtgcttctctggagcccgcgaggggcac
ctgcccagcctgctggccatgatccacgtcagacactgcacccccatccccgccctcctc
gtctgttgcggggccacagccatcatcatgcttgtgggcgacacatacacgctcatcaac
tatgtgtccttcatcaactacctctgctacggcgtcaccatcctgggcctgctgctgctg
cgctggaggcggcccgcactccacaggcccatcaaggtgaaccttctcatccccgtggcg
tacttggtcttctgggccttcctgctggtcttcagcttcatctcagagcctatggtctgt
ggggtcggcgtcatcatcatccttacgggggtgcccattttctttctgggagtgttctgg
agaagcaaaccaaagtgtgtgcacagactcacagagtccatgacacgctggggccaggag
ctgtgtttcgtggtctacccccaggatgcccccgaagaggagaatggcccctgcccaccg
tccctgctgcctgccacagacaagccctcgaagacacaatga

DBGET integrated database retrieval system