KEGG   Pongo abelii (Sumatran orangutan): 100440745
Entry
100440745         CDS       T01416                                 

Gene name
SP1
Definition
(RefSeq) transcription factor Sp1 isoform X1
  KO
K04684  transcription factor Sp1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04137  Mitophagy - animal
pon04350  TGF-beta signaling pathway
pon04915  Estrogen signaling pathway
pon04927  Cortisol synthesis and secretion
pon04928  Parathyroid hormone synthesis, secretion and action
pon04934  Cushing syndrome
pon05016  Huntington disease
pon05017  Spinocerebellar ataxia
pon05163  Human cytomegalovirus infection
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05224  Breast cancer
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100440745 (SP1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100440745 (SP1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100440745 (SP1)
   04928 Parathyroid hormone synthesis, secretion and action
    100440745 (SP1)
   04927 Cortisol synthesis and secretion
    100440745 (SP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100440745 (SP1)
   05202 Transcriptional misregulation in cancer
    100440745 (SP1)
   05231 Choline metabolism in cancer
    100440745 (SP1)
  09162 Cancer: specific types
   05224 Breast cancer
    100440745 (SP1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    100440745 (SP1)
   05017 Spinocerebellar ataxia
    100440745 (SP1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100440745 (SP1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100440745 (SP1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100440745 (SP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100440745 (SP1)
   03029 Mitochondrial biogenesis [BR:pon03029]
    100440745 (SP1)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    100440745 (SP1)
Mitochondrial biogenesis [BR:pon03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    100440745 (SP1)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_8 zf-C2H2_6
Other DBs
NCBI-GeneID: 100440745
NCBI-ProteinID: XP_002823363
Ensembl: ENSPPYG00000004579
UniProt: A0A663DCW8 H2NHH0
LinkDB
Position
12
AA seq 786 aa
MSDQDHSMDEMTAVVKIEKGVGGSNGGNGNGGGAFSQARSSSTGSSSSSGGGGGQESQPS
PLALLAATCSRIESPNENSNNSQGPSQSGGTGELDLTATQLSQGANGWQIISSSSGATPT
SKEQSGSSTNGSNGSESSKNRTVSGGQYVVAATPNLQNQQVLTGLPGVMPNIQYQVIPQF
QTVDGQQLQFAATGAQVQQDGSGQIQIIPGANQQIITNRGSGGNIIAAMPNLLQQAVPLQ
GLANNVLSGQTQYVTNVPVALNGNITLLPVNSVSAATLTPSSQAVTISSSGSQESGSQPV
TSGTTISSASLVSSQASSSSFFTNANSYSTTTTTSNMGIMNFTTSGSSGTNSQGQTPQRV
SGLQGSDALNIQQNQTSGGSLQAGQQKEGEQNQQTQQQQILIQPQLVQGGQALQALQAAP
LSGQTFTTQAISQETLQNLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQA
QTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGT
SGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRT
RREACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCT
WSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVAL
SVGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSIN
ISGNGF
NT seq 2361 nt   +upstreamnt  +downstreamnt
atgagcgaccaagatcactccatggatgaaatgacagctgtggtgaagattgaaaaagga
gttggtggcagtaatgggggcaatggtaatggtggtggtgccttttcacaggctcgaagt
agcagcacaggcagtagcagcagcagtggaggaggaggagggcaggagtcccagccatcc
cctttggctctgctggcagcaacttgcagcagaattgagtcacccaatgagaacagcaac
aactcccagggcccgagtcagtcagggggaacaggtgagcttgacctcacagccacacaa
ctttcacagggtgccaatggctggcagatcatctcttcctcctctggggctacccctacc
tcaaaggaacagagtggcagcagtaccaatggcagcaatggcagtgagtcttccaagaat
cgcacagtctctggtgggcagtatgttgtggctgccactcccaacttacagaaccagcaa
gttctgacaggactacctggagtgatgcctaatattcagtatcaagtaatcccacagttc
cagaccgttgatgggcaacagctgcagtttgctgccactggggcccaagtgcagcaggat
ggttctggtcaaatacagatcataccaggtgcaaaccaacagattatcacaaatcgagga
agtggaggcaacatcattgctgctatgccaaacctactccagcaggctgtccccctccaa
ggcctggctaataacgtactctcaggacagactcagtatgtgaccaatgtaccagtggcc
ctgaatgggaacatcaccttgctacctgtcaacagcgtttctgcagctaccttgactccc
agctctcaggcagtcacgatcagcagctctgggtcccaggagagtggctcacagcctgtc
acctcagggactaccatcagttctgccagcttggtgtcatcacaagccagttccagctcc
tttttcaccaatgccaatagctactcaactactactaccaccagcaacatgggaattatg
aactttactaccagtggatcatcagggaccaactctcaaggccagacaccccagagggtc
agtgggctacaggggtctgatgctctgaacatccagcaaaaccagacatctggaggctca
ttgcaagcaggccagcaaaaagaaggagagcaaaaccagcagacacagcagcaacaaatt
cttatccagcctcagctagttcaagggggacaggccctccaggccctccaagcagcacca
ttgtcagggcagacctttacaactcaagccatctcccaggaaaccctccagaatctccag
cttcaggctgttccaaactctggtcccatcatcatccggacaccaacagtggggcccaat
ggacaggtcagttggcagactctacagctgcagaacctccaagttcagaacccacaagcc
cagacaatcaccttagccccaatgcagggtgtttccttggggcagaccagcagcagcaac
accactctcacacccattgcctcagctgcttccattcctgctggcacagtcactgtgaat
gctgctcaactctcctccatgccaggcctccagaccattaacctcagtgcattgggtact
tcaggaatccaggtgcacccaattcaaggcctgccgttggctatagcaaatgccccaggt
gatcatggagctcagcttggtctccacggggctggtggtgatggaatacatgatgacaca
gcaggtggagaggaaggagaaaacagcccagatgcccaaccccaagccggtcggaggacc
cggcgggaagcatgcacctgcccctactgtaaagacagtgaaggaaggggctcgggggat
cctggcaaaaagaaacagcatatttgccacatccaaggctgtgggaaagtgtatggcaag
acctcacacctgcgggcacacttgcgctggcatacaggcgagaggccatttatgtgtacc
tggtcatactgtgggaaacgcttcacacgttcggatgagctacagaggcacaaacgtaca
cacacaggtgagaagaaatttgcctgccctgagtgtcctaagcgcttcatgaggagtgac
cacctgtcaaaacatatcaagacccaccagaataagaagggaggcccaggtgtagctctg
agtgtgggcactttgcccctggacagtggggcaggttcagaaggcagcggcactgccact
ccttcagcccttattaccaccaatatggtagccatggaggccatctgtccagagggcatt
gcccgtcttgccaacagtggcatcaacgtcatgcaggtggcagatctgcagtccattaat
atcagtggcaatggcttctga

KEGG   Pongo abelii (Sumatran orangutan): 100450292
Entry
100450292         CDS       T01416                                 

Gene name
JUN
Definition
(RefSeq) transcription factor AP-1
  KO
K04448  transcription factor AP-1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04024  cAMP signaling pathway
pon04137  Mitophagy - animal
pon04210  Apoptosis
pon04310  Wnt signaling pathway
pon04380  Osteoclast differentiation
pon04510  Focal adhesion
pon04530  Tight junction
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04625  C-type lectin receptor signaling pathway
pon04657  IL-17 signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon04660  T cell receptor signaling pathway
pon04662  B cell receptor signaling pathway
pon04668  TNF signaling pathway
pon04722  Neurotrophin signaling pathway
pon04912  GnRH signaling pathway
pon04915  Estrogen signaling pathway
pon04921  Oxytocin signaling pathway
pon04926  Relaxin signaling pathway
pon04932  Non-alcoholic fatty liver disease
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05030  Cocaine addiction
pon05031  Amphetamine addiction
pon05132  Salmonella infection
pon05133  Pertussis
pon05135  Yersinia infection
pon05140  Leishmaniasis
pon05142  Chagas disease
pon05161  Hepatitis B
pon05162  Measles
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05210  Colorectal cancer
pon05211  Renal cell carcinoma
pon05224  Breast cancer
pon05231  Choline metabolism in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pon05321  Inflammatory bowel disease
pon05323  Rheumatoid arthritis
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100450292 (JUN)
   04012 ErbB signaling pathway
    100450292 (JUN)
   04310 Wnt signaling pathway
    100450292 (JUN)
   04668 TNF signaling pathway
    100450292 (JUN)
   04024 cAMP signaling pathway
    100450292 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    100450292 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    100450292 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100450292 (JUN)
   04530 Tight junction
    100450292 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100450292 (JUN)
   04621 NOD-like receptor signaling pathway
    100450292 (JUN)
   04625 C-type lectin receptor signaling pathway
    100450292 (JUN)
   04660 T cell receptor signaling pathway
    100450292 (JUN)
   04658 Th1 and Th2 cell differentiation
    100450292 (JUN)
   04659 Th17 cell differentiation
    100450292 (JUN)
   04657 IL-17 signaling pathway
    100450292 (JUN)
   04662 B cell receptor signaling pathway
    100450292 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100450292 (JUN)
   04915 Estrogen signaling pathway
    100450292 (JUN)
   04921 Oxytocin signaling pathway
    100450292 (JUN)
   04926 Relaxin signaling pathway
    100450292 (JUN)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100450292 (JUN)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100450292 (JUN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100450292 (JUN)
   05203 Viral carcinogenesis
    100450292 (JUN)
   05231 Choline metabolism in cancer
    100450292 (JUN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100450292 (JUN)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100450292 (JUN)
   05211 Renal cell carcinoma
    100450292 (JUN)
   05224 Breast cancer
    100450292 (JUN)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100450292 (JUN)
   05321 Inflammatory bowel disease
    100450292 (JUN)
  09165 Substance dependence
   05030 Cocaine addiction
    100450292 (JUN)
   05031 Amphetamine addiction
    100450292 (JUN)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100450292 (JUN)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100450292 (JUN)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100450292 (JUN)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100450292 (JUN)
   05135 Yersinia infection
    100450292 (JUN)
   05133 Pertussis
    100450292 (JUN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100450292 (JUN)
   05170 Human immunodeficiency virus 1 infection
    100450292 (JUN)
   05161 Hepatitis B
    100450292 (JUN)
   05171 Coronavirus disease - COVID-19
    100450292 (JUN)
   05162 Measles
    100450292 (JUN)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100450292 (JUN)
   05169 Epstein-Barr virus infection
    100450292 (JUN)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100450292 (JUN)
   05142 Chagas disease
    100450292 (JUN)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100450292 (JUN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100450292 (JUN)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    100450292 (JUN)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha TFIIA FlaC_arch NBP1 Jnk-SapK_ap_N DUF3450
Other DBs
NCBI-GeneID: 100450292
NCBI-ProteinID: XP_002810809
Ensembl: ENSPPYG00000001295
UniProt: H2N785
LinkDB
Position
1
AA seq 334 aa
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPG
ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST
ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctatgacgatgccctcaacgcctcgttcctcccg
tccgagagcggaccttatggctacagtaaccccaagatcctgaaacagagcatgaccctg
aacctggccgacccagtggggagcctgaagccgcacctccgtgcgaagaactcggacctc
ctcacctcgcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctgata
atccagtccagcaacgggcacatcaccaccacgccgacccccacccagttcctgtgcccc
aagaacgtgacagacgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgaa
ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccggtcaacggggcg
ggcatggtggctcccgcggtagcctcggtggcagggggcagcggcagcggtggcttcagc
gccagcctgcacagcgagccgccggtctacgccaacctcagcaacttcaacccaggcgcg
ctgagcagcggcggcggggcgccctcctacggcgcggccggcctggcctttcccgcgcaa
ccccagcagcagcagcagccgccgcagccgccgcaccacctgccccagcagatgcccgtg
cagcacccgcggctgcaggccctgaaggaggagcctcagacagtgcccgagatgccgggc
gagacaccgcccctgtcccccatcgacatggagtcccaggagcggatcaaggcggagagg
aagcgcatgaggaaccgcatcgctgcctccaagtgccgaaaaaggaagctggagagaatc
gcccggctggaggaaaaagtgaaaaccttgaaagctcagaactcggagctggcgtccacg
gccaacatgctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaac
agtgggtgccaactcatgctaacgcagcagttgcaaacattttga

KEGG   Pongo abelii (Sumatran orangutan): 100462290
Entry
100462290         CDS       T01416                                 

Gene name
FOS
Definition
(RefSeq) proto-oncogene c-Fos
  KO
K04379  proto-oncogene protein c-fos
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04010  MAPK signaling pathway
pon04024  cAMP signaling pathway
pon04210  Apoptosis
pon04380  Osteoclast differentiation
pon04620  Toll-like receptor signaling pathway
pon04657  IL-17 signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon04660  T cell receptor signaling pathway
pon04662  B cell receptor signaling pathway
pon04668  TNF signaling pathway
pon04713  Circadian entrainment
pon04725  Cholinergic synapse
pon04728  Dopaminergic synapse
pon04915  Estrogen signaling pathway
pon04917  Prolactin signaling pathway
pon04921  Oxytocin signaling pathway
pon04926  Relaxin signaling pathway
pon04928  Parathyroid hormone synthesis, secretion and action
pon04932  Non-alcoholic fatty liver disease
pon04935  Growth hormone synthesis, secretion and action
pon05031  Amphetamine addiction
pon05132  Salmonella infection
pon05133  Pertussis
pon05135  Yersinia infection
pon05140  Leishmaniasis
pon05142  Chagas disease
pon05161  Hepatitis B
pon05162  Measles
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05210  Colorectal cancer
pon05224  Breast cancer
pon05231  Choline metabolism in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pon05323  Rheumatoid arthritis
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100462290 (FOS)
   04668 TNF signaling pathway
    100462290 (FOS)
   04024 cAMP signaling pathway
    100462290 (FOS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100462290 (FOS)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100462290 (FOS)
   04660 T cell receptor signaling pathway
    100462290 (FOS)
   04658 Th1 and Th2 cell differentiation
    100462290 (FOS)
   04659 Th17 cell differentiation
    100462290 (FOS)
   04657 IL-17 signaling pathway
    100462290 (FOS)
   04662 B cell receptor signaling pathway
    100462290 (FOS)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100462290 (FOS)
   04917 Prolactin signaling pathway
    100462290 (FOS)
   04921 Oxytocin signaling pathway
    100462290 (FOS)
   04926 Relaxin signaling pathway
    100462290 (FOS)
   04935 Growth hormone synthesis, secretion and action
    100462290 (FOS)
   04928 Parathyroid hormone synthesis, secretion and action
    100462290 (FOS)
  09156 Nervous system
   04725 Cholinergic synapse
    100462290 (FOS)
   04728 Dopaminergic synapse
    100462290 (FOS)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100462290 (FOS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    100462290 (FOS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100462290 (FOS)
   05231 Choline metabolism in cancer
    100462290 (FOS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100462290 (FOS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100462290 (FOS)
   05224 Breast cancer
    100462290 (FOS)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100462290 (FOS)
  09165 Substance dependence
   05031 Amphetamine addiction
    100462290 (FOS)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100462290 (FOS)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100462290 (FOS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100462290 (FOS)
   05135 Yersinia infection
    100462290 (FOS)
   05133 Pertussis
    100462290 (FOS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100462290 (FOS)
   05170 Human immunodeficiency virus 1 infection
    100462290 (FOS)
   05161 Hepatitis B
    100462290 (FOS)
   05171 Coronavirus disease - COVID-19
    100462290 (FOS)
   05162 Measles
    100462290 (FOS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100462290 (FOS)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100462290 (FOS)
   05142 Chagas disease
    100462290 (FOS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100462290 (FOS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100462290 (FOS)
   04131 Membrane trafficking [BR:pon04131]
    100462290 (FOS)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    100462290 (FOS)
Membrane trafficking [BR:pon04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100462290 (FOS)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin DUF3450 HALZ
Other DBs
NCBI-GeneID: 100462290
NCBI-ProteinID: XP_002824996
Ensembl: ENSPPYG00000006002
UniProt: A0A6D2W783 A0A2J8W665
LinkDB
Position
14
AA seq 380 aa
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF
IPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPTPSAGAYSRAGVVKTMTGGRA
QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFT
LPLLNDPEPKPSVEPVKSISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA
ADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRK
GSSSNEPSSDSLSSPTLLAL
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgatgttctcgggcttcaacgcagactacgaggcgtcatcctcccgctgcagcagcgcg
tccccggccggggatagcctctcctactaccactcacccgccgactccttctccagcatg
ggctcgcctgtcaacgcgcaggacttctgcacggacctggccgtctccagtgccaacttc
attcccacggtcactgccatctcgaccagtccggacctgcagtggctggtgcagcctgcc
ctcgtctcctccgtggccccatcgcagaccagagcccctcaccctttcggagtccccacc
ccctccgctggggcttactccagggctggcgttgtgaagaccatgacaggaggccgagcg
cagagcattggcaggaggggcaaggtggaacagttatctccagaagaagaagagaaaagg
agaatccgaagggaaaggaataagatggctgcagccaaatgccgcaaccggaggagggag
ctgactgatacactccaagcggagacagaccaactagaagatgagaagtctgctttgcag
accgagattgccaacctgctaaaggagaaggaaaaactagagttcatcctggcagctcac
cgacctgcctgcaagatccctgatgacctgggcttcccagaagagatgtctgtggcttcc
cttgatctgactgggggcctgccagaggttgccaccccggagtctgaggaggccttcacc
ctgcctctcctcaatgaccctgagcccaagccctcagtggaacctgtcaagagcatcagc
agcatggagctgaaggccgagccgtttgatgacttcctgttcccagcatcatccaggccc
agcggctctgagacagcccgctctgtgccagacatggacctatctgggtccttctatgca
gcagactgggagcctctgcacagtggctccctgggaatggggcccatggccacagagctg
gagcccctgtgcactccggtggtcacctgtactcccagctgcactgcttacacgtcttcc
ttcgtcttcacctaccccgaggctgactccttccccagctgcgcagctgcccaccgcaag
ggcagcagcagcaatgagccttcctctgactcgctcagctcacccacgctgctggcccta
tga

DBGET integrated database retrieval system