KEGG   Pongo abelii (Sumatran orangutan): 100440778
Entry
100440778         CDS       T01416                                 

Gene name
PRKCE
Definition
(RefSeq) protein kinase C epsilon type
  KO
K18050  novel protein kinase C epsilon type [EC:2.7.11.13]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04022  cGMP-PKG signaling pathway
pon04071  Sphingolipid signaling pathway
pon04270  Vascular smooth muscle contraction
pon04371  Apelin signaling pathway
pon04530  Tight junction
pon04666  Fc gamma R-mediated phagocytosis
pon04750  Inflammatory mediator regulation of TRP channels
pon04925  Aldosterone synthesis and secretion
pon04930  Type II diabetes mellitus
pon04931  Insulin resistance
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100440778 (PRKCE)
   04071 Sphingolipid signaling pathway
    100440778 (PRKCE)
   04022 cGMP-PKG signaling pathway
    100440778 (PRKCE)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100440778 (PRKCE)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100440778 (PRKCE)
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    100440778 (PRKCE)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100440778 (PRKCE)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100440778 (PRKCE)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100440778 (PRKCE)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100440778 (PRKCE)
   04931 Insulin resistance
    100440778 (PRKCE)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100440778 (PRKCE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100440778 (PRKCE)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     100440778 (PRKCE)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   100440778 (PRKCE)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C FTA2 Kinase-like Kdo
Other DBs
NCBI-GeneID: 100440778
NCBI-ProteinID: XP_002812114
Ensembl: ENSPPYG00000012443
UniProt: H2P6C3 A0A663D6U8
LinkDB
Position
2A
AA seq 737 aa
MVVFNGLLKIKICEAVSLKPTAWSLRHAVGPRPQTFLLDPYIALNVDDSRIGQTATKQKT
NSPAWHDEFVTDVCNGRKIELAVFHDAPIGYDDFVANCTIQFEELLQNGSRHFEDWIDLE
PEGRVYVIIDLSGSSGEAPKDNEERVFRERMRPRKRQGAVRRRVHQVNGHKFMATYLRQP
TYCSHCRDFIWGVIGKQGYQCQVCTCVVHKRCHELIITKCAGLKKQETPDQVGSQRFSVN
MPHKFGIHNYKVPTFCDHCGSLLWGLLRQGLQCKVCKMNVHRRCETNVAPNCGVDARGIA
KVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPSEEDRSKSAPTSPCDQEIKELE
NNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQAKRLGLDEFNFIKVLGKGSFG
KVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKD
RLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILL
DAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEM
MAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGED
AIKQHPFFKEIDWVLLEQKKIKPPFKPRIKTKRDVNNFDQDFTREEPVLTLVDEAIVKQI
NQEEFKGFSYFGEDLMP
NT seq 2214 nt   +upstreamnt  +downstreamnt
atggtagtgttcaatggccttcttaagatcaaaatctgcgaggccgtgagcttgaagccc
acagcctggtcgctgcgccatgcggtgggaccccggccgcagactttccttctcgacccc
tacattgccctcaatgtggacgactcgcgcatcggccaaacggccaccaagcagaagacc
aacagcccggcctggcacgacgagttcgtcaccgatgtgtgcaacgggcgcaagatcgag
ctggctgtctttcacgatgcccccataggctacgacgacttcgtggccaactgcaccatc
cagtttgaggagctgctgcagaacgggagccgccacttcgaggactggattgatctggag
ccagaaggaagagtgtatgtgatcatcgatctctcagggtcgtcgggtgaagcccctaaa
gacaatgaagagcgtgtgttcagggaacgcatgcggccgaggaagcggcagggggccgtc
aggcgcagggtccatcaggtcaacggccacaagttcatggccacctatcttcggcagccc
acctactgctcccattgcagagacttcatctggggtgtcataggaaagcagggataccag
tgtcaagtttgcacctgtgtggtccacaagcgatgccacgagctcataatcacgaagtgt
gctgggttaaagaagcaggagacccctgaccaggtgggctcccagcggttcagcgtcaac
atgccccacaagttcggtatccacaactacaaggtccccaccttctgcgatcactgtggg
tccctgctctggggactcttgcggcagggtttgcagtgtaaagtctgcaaaatgaatgtt
caccgtcgatgtgagaccaacgtggctcccaactgtggagtggatgccagaggaatcgcc
aaagtcctggccgacctgggcgttaccccagacaaaatcaccaacagcggccagaggagg
aaaaagctcattgctggtgccgagtccccgcagcctgcttctggaagctcaccatctgag
gaagatcgatccaagtcagcacccacctccccttgtgaccaggaaataaaagaacttgag
aacaacattcggaaagccttgtcatttgacaaccgaggggaggagcaccgggcagcatcg
tctcctgatggccagctgatgagccctggtgagaacggcgaagtccggcaaggccaggcc
aagcgcctgggcctggatgagttcaacttcatcaaggtgttaggcaaaggcagctttggc
aaggtcatgttggcagaactcaagggcaaagatgaagtatatgctgtgaaggtcttaaag
aaggacgtcatccttcaggatgatgacgtggactgcacaatgacagagaagagaattttg
gctctggcacggaaacacccataccttacccaactctactgctgcttccagaccaaggac
cgcctctttttcgtcatggaatatgtaaatggtggagacctcatgtttcagattcagcgc
tcccgaaaattcgacgagcctcgttcacggttctatgctgcagaggtcacatcagccctc
atgttcctccaccagcatggagtcatctacagggatttgaaactggacaacatccttctg
gatgcagaaggtcactgcaagctggctgacttcgggatgtgcaaggaagggattctgaat
ggtgtgacaaccaccacgttctgtgggactcctgactacatagctcctgagatcctgcag
gagttggagtacggcccctccgtggactggtgggccctgggggtgctgatgtacgagatg
atggctggacagcctccctttgaggccgacaatgaggacgacctatttgagtccatcctc
catgacgacgtgctctacccagtctggctcagcaaggaggctgtcagcatcttgaaagct
ttcatgacgaagaatccccacaagcgcctgggctgcgtggcatcacagaacggcgaggac
gccatcaagcagcacccattcttcaaagagattgactgggtgctcctggagcagaagaag
atcaagccacccttcaaaccacgcattaaaaccaaaagagacgtcaataattttgaccaa
gactttacacgggaagagccggtactcacccttgtggacgaagcaattgtaaagcagatc
aaccaggaggaattcaaaggtttctcctactttggtgaagacctgatgccctga

DBGET integrated database retrieval system