KEGG   Pongo abelii (Sumatran orangutan): 100440788Help
Entry
100440788         CDS       T01416                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4 isoform X1
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04371  Apelin signaling pathway
pon05034  Alcoholism
pon05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100440788 (HDAC4)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    100440788 (HDAC4)
  09165 Substance dependence
   05034 Alcoholism
    100440788 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100440788 (HDAC4)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100440788 (HDAC4)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100440788 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 100440788
NCBI-ProteinID: XP_024099234
LinkDB All DBs
Position
2B
AA seq 1089 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLP
VAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLA
MKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVL
NKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSTSYNHPVLGMYDAKDDFP
LRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSGP
SSPNNSSGSVSAENGITPTVPSIPAETSLAHRLVAREGSAAPLPLYTSPSLPNITLGLPA
TGPSAGTAGQQDAERLALPTLQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLL
EQPPAQAPLVTDWYLSGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQ
ALQHLVIQQQHQQFLEKHKQQFQQQQLHMNKIIPKPSEPARQPESHPEETEEELREHQAL
LDEPYLDRLPGQKEAHAPAGVQVKQEPIESDDEEAEPPREVEPGQRQPSEQELLFRQQAL
LLEQQRIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPVSVQEPPTKPRFTTG
LVYDTLMLKHQCTCGSSSSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVH
SEAHTLLYGTNPLNRQKLDSKKLLGSLASVFVRLPCGGVGVDSDTIWNEVHSAGAARLAV
GCVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQRLSVSKIL
IVDWDVHHGNGTQQAFYSDPSVLYVSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFT
GGLDPPMGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSARCFGY
LTKQLMGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVR
SMEKVMEIHSKYWRCLQRATSTAGRSLIEAQTCENEEAETVTAMASLSVGVKPAEKRPDE
EPMEEEPPL
NT seq 3270 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaaagccatccagatggactttctggccgagaccagccagtggagctgctg
aatcctgcccgcgtgaaccacatgcccagcacggtggatgtggccacggcgctgcctctg
caagtggccccctcggcagtgcccatggacctgcgcctggaccaccagttctcactgcct
gtggcagagccggccctgcgggagcagcagctgcagcaggagctcctggcgctcaagcag
aagcagcagatccagaggcagatcctcatcgccgagttccagagacagcacgagcagctc
tcccggcagcacgaggcgcagctccacgagcacatcaagcaacagcaggagatgctggcc
atgaagcaccagcaggagctgctggaacaccagcggaagctggagaggcaccgccaggag
caggagctggagaagcagcaccgggagcagaagctgcagcagctcaagaacaaggagaag
ggcaaagagagtgccgtggccagcacggaagtgaagatgaagttacaagaatttgtcctc
aataaaaagaaggcgctggcccaccggaatctgaaccactgcatttccagcgaccctcgc
tactggtacgggaaaacgcagcacagttcccttgaccagagttctccaccccagagcgga
gtgtcgacctcctataaccacccggtcctgggaatgtacgacgccaaagatgacttccct
cttaggaaaacagcttctgaaccgaatctgaaattacggtccaggctaaagcagaaagtg
gccgaaagacggagcagccccctgttacgcaggaaagacgggccagtggtcactgctcta
aaaaagcgtccgttggatgtcacagactccgcgtgcagcagcgccccaggctccggaccc
agctcacccaacaacagctccgggagcgtcagcgcggagaacggtatcacgcccaccgtc
cccagcatcccggcggagacgagtttggcgcacagacttgtggcgcgagaaggctcggcc
gctccacttcccctctacacatcgccatccctgcccaacatcacactgggcctgcctgcc
accggcccttccgctggcacagcgggccagcaggacgccgagagactcgcccttcccacc
ctccagcagaggctctcccttttccccggcacccacctcactccctacctgagcacctcg
cccttggagcgggatggaggggcagcgcacagccctcttctgcagcacatggtcttactg
gagcagccaccggcacaagcgcccctcgtcacagactggtatctttcaggcctgggagca
ctgcccctccacgcacagtccttggttggtgcagaccgggtgtccccctccatccacaag
ctgcggcagcaccgcccgctggggcggacccagtcggccccactgccccagaacgcccag
gctctgcagcacctggtcatccagcagcaacatcagcagtttctggagaaacacaagcag
cagttccagcagcagcaactgcacatgaacaagatcatccccaagccaagcgagccagcc
cggcagccagagagccacccggaggagacggaggaggagctccgtgagcaccaggctctg
ctggacgagccctacctggaccggctgccggggcagaaggaggcgcacgcaccggccggc
gtgcaggtgaagcaggagcccattgaaagcgatgacgaagaggcggagcccccgcgggag
gtggagcccggccaacgccagcccagtgagcaggagctgctcttcagacagcaagccctc
ctgctggagcagcagcggatccaccagctgaggaactaccaggcatccatggaggccgcc
ggcatccccgtgtcctttggcggccacaggcctctgtcccgggcgcagtcctcacccgca
tctgccaccttccccgtgtctgtgcaggagccccccaccaagccgaggttcacgacaggc
ctcgtgtatgacacgctgatgctgaagcaccagtgcacctgcgggagcagcagcagccac
cccgagcacgccgggaggatccagagcatctggtcccgcctgcaggagacaggcctccgg
ggcaaatgtgagtgcatccgcggacgaaaggccaccctggaggagctgcagacggtgcac
tcggaagcccacaccctcctgtacggcacgaaccccctcaaccggcagaaactggacagt
aagaaacttctaggctccctggcctccgtgttcgtccggctcccctgcggtggtgttggg
gtggacagtgacaccatatggaacgaggtgcactcggcgggggcagcccgcctggctgtg
ggctgtgtggtagagctggtcttcaaggtggccacgggggagctgaagaatggctttgct
gtggtccgcccccctggacaccatgcggaggagagcacacccatgggcttttgctacttc
aactccgtggccgtggcagccaagcttctgcagcagaggttgagtgtgagcaagatcctc
atcgtggactgggacgtgcaccatggaaacgggacccagcaggctttctacagtgacccc
agcgtcctgtacgtgtccctccaccgctacgacgatgggaacttcttcccaggcagcggg
gctcctgatgaggtgggcacagggcccggcgtgggtttcaacgtcaacatggctttcacc
ggcggcctggacccccccatgggagacgctgagtacttggcggccttcagaacggtggtc
atgccaatcgccagcgagtttgccccggacgtggtgctggtgtcatcaggcttcgatgct
gtggagggccaccccacacctctcgggggctacaacctctccgccagatgcttcgggtac
ctgacgaagcagctgatgggcctggctggcggccggatcgtcctggccctcgagggaggc
cacgacctgaccgccatttgcgacgcctccgaagcatgtgtttctgccttgctgggaaat
gagcttgatcctctcccagaaaaggttttacagcaaagacccaatgcaaacgctgtccgc
tccatggagaaagtcatggagatccacagcaagtactggcgctgcctccagcgcgcaacc
tccacagcggggcgttctctgatcgaggctcagacttgcgagaacgaagaagccgagacg
gtcaccgccatggcctcgctgtctgtgggcgtgaagcccgccgaaaagagaccagacgag
gagcccatggaagaggagccgcccctgtag

DBGET integrated database retrieval system