KEGG   Pongo abelii (Sumatran orangutan): 100440788
Entry
100440788         CDS       T01416                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4 isoform X1
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04371  Apelin signaling pathway
pon04613  Neutrophil extracellular trap formation
pon05034  Alcoholism
pon05203  Viral carcinogenesis
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100440788 (HDAC4)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100440788 (HDAC4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100440788 (HDAC4)
   05203 Viral carcinogenesis
    100440788 (HDAC4)
  09165 Substance dependence
   05034 Alcoholism
    100440788 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100440788 (HDAC4)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100440788 (HDAC4)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100440788 (HDAC4)
SSDB
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Other DBs
NCBI-GeneID: 100440788
NCBI-ProteinID: XP_024099234
LinkDB
Position
2B
AA seq 1089 aa
MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLP
VAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLA
MKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVL
NKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSTSYNHPVLGMYDAKDDFP
LRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSGP
SSPNNSSGSVSAENGITPTVPSIPAETSLAHRLVAREGSAAPLPLYTSPSLPNITLGLPA
TGPSAGTAGQQDAERLALPTLQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLL
EQPPAQAPLVTDWYLSGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQ
ALQHLVIQQQHQQFLEKHKQQFQQQQLHMNKIIPKPSEPARQPESHPEETEEELREHQAL
LDEPYLDRLPGQKEAHAPAGVQVKQEPIESDDEEAEPPREVEPGQRQPSEQELLFRQQAL
LLEQQRIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPVSVQEPPTKPRFTTG
LVYDTLMLKHQCTCGSSSSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVH
SEAHTLLYGTNPLNRQKLDSKKLLGSLASVFVRLPCGGVGVDSDTIWNEVHSAGAARLAV
GCVVELVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQRLSVSKIL
IVDWDVHHGNGTQQAFYSDPSVLYVSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFT
GGLDPPMGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSARCFGY
LTKQLMGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVR
SMEKVMEIHSKYWRCLQRATSTAGRSLIEAQTCENEEAETVTAMASLSVGVKPAEKRPDE
EPMEEEPPL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atgagctcccaaagccatccagatggactttctggccgagaccagccagtggagctgctg
aatcctgcccgcgtgaaccacatgcccagcacggtggatgtggccacggcgctgcctctg
caagtggccccctcggcagtgcccatggacctgcgcctggaccaccagttctcactgcct
gtggcagagccggccctgcgggagcagcagctgcagcaggagctcctggcgctcaagcag
aagcagcagatccagaggcagatcctcatcgccgagttccagagacagcacgagcagctc
tcccggcagcacgaggcgcagctccacgagcacatcaagcaacagcaggagatgctggcc
atgaagcaccagcaggagctgctggaacaccagcggaagctggagaggcaccgccaggag
caggagctggagaagcagcaccgggagcagaagctgcagcagctcaagaacaaggagaag
ggcaaagagagtgccgtggccagcacggaagtgaagatgaagttacaagaatttgtcctc
aataaaaagaaggcgctggcccaccggaatctgaaccactgcatttccagcgaccctcgc
tactggtacgggaaaacgcagcacagttcccttgaccagagttctccaccccagagcgga
gtgtcgacctcctataaccacccggtcctgggaatgtacgacgccaaagatgacttccct
cttaggaaaacagcttctgaaccgaatctgaaattacggtccaggctaaagcagaaagtg
gccgaaagacggagcagccccctgttacgcaggaaagacgggccagtggtcactgctcta
aaaaagcgtccgttggatgtcacagactccgcgtgcagcagcgccccaggctccggaccc
agctcacccaacaacagctccgggagcgtcagcgcggagaacggtatcacgcccaccgtc
cccagcatcccggcggagacgagtttggcgcacagacttgtggcgcgagaaggctcggcc
gctccacttcccctctacacatcgccatccctgcccaacatcacactgggcctgcctgcc
accggcccttccgctggcacagcgggccagcaggacgccgagagactcgcccttcccacc
ctccagcagaggctctcccttttccccggcacccacctcactccctacctgagcacctcg
cccttggagcgggatggaggggcagcgcacagccctcttctgcagcacatggtcttactg
gagcagccaccggcacaagcgcccctcgtcacagactggtatctttcaggcctgggagca
ctgcccctccacgcacagtccttggttggtgcagaccgggtgtccccctccatccacaag
ctgcggcagcaccgcccgctggggcggacccagtcggccccactgccccagaacgcccag
gctctgcagcacctggtcatccagcagcaacatcagcagtttctggagaaacacaagcag
cagttccagcagcagcaactgcacatgaacaagatcatccccaagccaagcgagccagcc
cggcagccagagagccacccggaggagacggaggaggagctccgtgagcaccaggctctg
ctggacgagccctacctggaccggctgccggggcagaaggaggcgcacgcaccggccggc
gtgcaggtgaagcaggagcccattgaaagcgatgacgaagaggcggagcccccgcgggag
gtggagcccggccaacgccagcccagtgagcaggagctgctcttcagacagcaagccctc
ctgctggagcagcagcggatccaccagctgaggaactaccaggcatccatggaggccgcc
ggcatccccgtgtcctttggcggccacaggcctctgtcccgggcgcagtcctcacccgca
tctgccaccttccccgtgtctgtgcaggagccccccaccaagccgaggttcacgacaggc
ctcgtgtatgacacgctgatgctgaagcaccagtgcacctgcgggagcagcagcagccac
cccgagcacgccgggaggatccagagcatctggtcccgcctgcaggagacaggcctccgg
ggcaaatgtgagtgcatccgcggacgaaaggccaccctggaggagctgcagacggtgcac
tcggaagcccacaccctcctgtacggcacgaaccccctcaaccggcagaaactggacagt
aagaaacttctaggctccctggcctccgtgttcgtccggctcccctgcggtggtgttggg
gtggacagtgacaccatatggaacgaggtgcactcggcgggggcagcccgcctggctgtg
ggctgtgtggtagagctggtcttcaaggtggccacgggggagctgaagaatggctttgct
gtggtccgcccccctggacaccatgcggaggagagcacacccatgggcttttgctacttc
aactccgtggccgtggcagccaagcttctgcagcagaggttgagtgtgagcaagatcctc
atcgtggactgggacgtgcaccatggaaacgggacccagcaggctttctacagtgacccc
agcgtcctgtacgtgtccctccaccgctacgacgatgggaacttcttcccaggcagcggg
gctcctgatgaggtgggcacagggcccggcgtgggtttcaacgtcaacatggctttcacc
ggcggcctggacccccccatgggagacgctgagtacttggcggccttcagaacggtggtc
atgccaatcgccagcgagtttgccccggacgtggtgctggtgtcatcaggcttcgatgct
gtggagggccaccccacacctctcgggggctacaacctctccgccagatgcttcgggtac
ctgacgaagcagctgatgggcctggctggcggccggatcgtcctggccctcgagggaggc
cacgacctgaccgccatttgcgacgcctccgaagcatgtgtttctgccttgctgggaaat
gagcttgatcctctcccagaaaaggttttacagcaaagacccaatgcaaacgctgtccgc
tccatggagaaagtcatggagatccacagcaagtactggcgctgcctccagcgcgcaacc
tccacagcggggcgttctctgatcgaggctcagacttgcgagaacgaagaagccgagacg
gtcaccgccatggcctcgctgtctgtgggcgtgaagcccgccgaaaagagaccagacgag
gagcccatggaagaggagccgcccctgtag

KEGG   Pongo abelii (Sumatran orangutan): 100458256
Entry
100458256         CDS       T01416                                 

Gene name
HDAC5
Definition
(RefSeq) histone deacetylase 5 isoform X1
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04371  Apelin signaling pathway
pon04613  Neutrophil extracellular trap formation
pon05034  Alcoholism
pon05203  Viral carcinogenesis
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100458256 (HDAC5)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100458256 (HDAC5)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100458256 (HDAC5)
   05203 Viral carcinogenesis
    100458256 (HDAC5)
  09165 Substance dependence
   05034 Alcoholism
    100458256 (HDAC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:pon03036]
    100458256 (HDAC5)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100458256 (HDAC5)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100458256 (HDAC5)
SSDB
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Other DBs
NCBI-GeneID: 100458256
NCBI-ProteinID: XP_024090900
Ensembl: ENSPPYG00000008342
LinkDB
Position
17
AA seq 1123 aa
MNSPNESADGMSGREPSLEILPRTSLHSIPVTVEVKPVLPRAMPSSMGGGGGGSPSPVEL
RGALVGSVDPTLREQQLQQELLALKQQQQLQKQLLFAEFQKQHDHLTRQHEVQLQKHLKQ
QQEMLAAKQQQEMLAAKRQQELEQQRQREQQRQEELEKQRLEQQLLILRNKEKSKESAIA
STEVKLRLQEFLLSKSKEPTPGGLNHSLPQHPKCWGAHHASLDQSSPPQSGPPGTPPSYK
LPLPGPYDSRDDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGTVISTFKKRAVE
ITGAGPGASSVCNSAPGSGPSSPNSSHSTIAENGFTGSVPNIPTEMLPQHRALPLDSSPN
QFSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMS
TSSIPGCLLGVALEGDGSPHGHASLLQHVLLLEQARQQSTLIAVPLHGQSPLVTGERVAT
SMRTVGKLPRHRPLSRTQSSPLPQSPQALQQLVMQQQHQQFLEKQKQQQLQLGKILTKTG
ELPRQPTTHPEETEEELTEQQEALLGEGALTMPREGSTESESTQEDLEEEDEEEDGEEEE
DCIQVKDEEGESGAEEGPDLEEPGAGYKKLFSDAQPLQPLQVYQAPLSLATVPHQALGRT
QSSPAAPGGMKSPPDQPVKHLFTTGVVYDTFMLKHQCMCGNTHVHPEHAGRIQSIWSRLQ
ETGLLSKCERIRGRKATLDEIQTVHSEYHTLLYGTSPLNRQKLDSKKLLGPISQKMYAVL
PCGGIGVDSDTVWNEMHSSSAVRMAVGCLLELAFKVAAGELKNGFAIIRPPGHHAEESTA
MGFCFFNSVAITAKLLQQKLNVGKVLIVDWDIHHGNGTQQAFYNDPSVLYISLHRYDNGN
FFPGSGAPEEVGGGPGVGYNVNVAWIGGVDPPIGDVEYLTAFRTVVMPIAHEFSPDVVLV
SAGFDAVEGHLSPLGGYSVTARCFGHLTRQLMTLAGGRVVLALEGGHDLTAICDASEACV
SALLSVELQPLDEAVLQQKPNINAVATLEKVIEIQSKHWSCVQKFAAGLGRSLREAQAGE
TEEAETVSAMALLSVGAEQAQAAAAREHSPRPAEEPMEQEPAL
NT seq 3372 nt   +upstreamnt  +downstreamnt
atgaactctcccaacgagtcggcagatgggatgtcaggccgggaaccatccttggaaatc
ctgccgcggacttctctgcacagcatccctgtgacagtggaggtgaagccggtgctgcca
agagccatgcccagttccatggggggtgggggtggaggcagccccagccccgtggagcta
cggggggctctggtgggctctgtggaccccacactgcgggagcagcaactgcagcaggag
ctcctggcgctcaagcagcagcagcagctgcagaagcagctcctgttcgctgagttccag
aaacagcatgaccacctgacaaggcagcatgaagtccagctgcagaagcacctcaagcag
cagcaggagatgctggcagccaagcagcagcaggagatgctggcagccaagcggcagcag
gagctggagcagcagcggcagcgggagcagcagcggcaggaagagctggagaagcagcgg
ctggagcagcagctgctcatcctgcggaacaaggagaagagcaaagagagtgccattgcc
agtaccgaggtaaagctgaggctccaggaattcctcttgtcgaagtcaaaggagcccaca
ccaggcggcctcaaccattccctcccacagcaccccaaatgctggggagcccaccatgct
tctttggaccagagttcccctccccagagcggcccccctgggacgcctccctcctacaaa
ctgcctttgcctgggccctacgacagtcgagacgacttccccctccgcaaaacagcctct
gaacccaacttgaaagtgcgttcaaggctaaaacagaaggtggccgagcggagaagcagt
cccctcctgcgtcgcaaggatgggactgttattagcacctttaagaagagagctgttgag
atcacaggtgccgggcctggggcgtcgtccgtgtgtaacagcgcacccggctccggcccc
agctctcctaacagctcccacagcaccatcgctgagaatggctttactggctcagtcccc
aacatccccaccgagatgctccctcagcaccgagccctccctctggacagctcccccaac
cagttcagcctctacacgtctccttctctgcccaacatctccctagggctgcaggccacg
gtgactgtcaccaactcacacctcactgcctccccgaagctgtcgacacagcaggaggcc
gagaggcaggccctccagtccctgcggcagggtggcacgctgaccggcaagttcatgagc
acatcctctatccctggctgcctgctgggcgtggcactggagggcgacgggagcccccac
gggcatgcctccctgctgcagcatgtgctgttgctggagcaggcccggcagcagagcacc
ctcattgctgtgccactccacgggcagtccccactagtgacgggtgaacgtgtggccacc
agcatgcggacggtaggcaagctcccgcggcatcggcccctgagccgcactcagtcctca
ccgctgccgcagagtccccaggccctgcagcagctggtcatgcaacaacagcaccagcag
ttcctggagaagcagaagcagcagcagctacagctgggcaagatcctcaccaagactggg
gagctgcccaggcagcccaccacccaccctgaggagacagaggaggagctgacggagcag
caggaggccttgctgggggagggagccctgaccatgccccgggagggctccacagagagt
gagagcacacaggaagacctggaggaggaggatgaggaagaggatggggaggaagaggag
gattgcatccaggtcaaggacgaagagggcgagagtggtgctgaggaggggcctgacttg
gaggagcctggtgctggttacaaaaaactgttctcagatgcccagccgctgcagcctctg
caggtgtaccaggcgcccctcagcctggccactgtgccccaccaggccctgggccgcacc
cagtcctcccctgctgcccctgggggcatgaagagccccccagaccagcccgtcaagcac
ctcttcaccacaggtgtggtctacgacacgttcatgctaaagcaccagtgcatgtgcggg
aacacacacgtgcaccctgagcatgctggccggatccagagcatctggtcccggctgcag
gagacaggcctgcttagcaagtgcgagcggatccgaggtcgcaaagccacgctagatgag
atccagacagtgcactctgaataccacaccctgctctatgggaccagccccctcaaccgg
cagaagctagacagcaagaagttgctcggccccatcagccagaagatgtatgctgtgctg
ccttgtgggggcatcggggtggacagtgacaccgtgtggaatgagatgcactcctccagt
gctgtgcgcatggcagtgggctgcctgctggagctggccttcaaggtggctgcaggagag
ctcaagaatggatttgccatcatccggcccccaggacaccacgccgaggaatccacagcc
atgggattctgcttcttcaactctgtagccatcactgcaaaactcctacagcagaagttg
aacgtgggcaaggtcctcatcgtggactgggacattcaccatggcaatggcacccagcag
gcgttctacaacgacccctctgtgctctacatctctctgcatcgctatgacaacgggaac
ttctttccaggctctggggctcctgaagaggttggtggagggccaggcgtggggtacaat
gtgaacgtggcatggataggaggtgtggacccccccattggagacgtggagtaccttaca
gccttcaggacagtggtgatgcccattgcccacgagttctcacctgacgtggtcctagtc
tctgccgggtttgatgctgttgaaggacatctgtctcctctgggtggctactctgtcacc
gccagatgttttggccacttgaccaggcagctgatgaccctggcagggggccgggtggtg
ctggccctggagggaggccatgacttgaccgccatctgtgatgcctctgaggcttgtgtc
tcggctctgctgagtgtagagctgcagcccttggacgaggcagtcttgcagcaaaagccc
aacatcaacgcagtggccacgctagagaaagtcatcgagatccagagcaaacactggagc
tgtgtgcagaagtttgccgctggtctgggccgttccctgcgagaggcccaagcaggtgag
accgaggaggccgagactgtgagcgccatggccttgctgtcggtgggggccgagcaggcc
caggctgcagcagcccgggagcacagccccaggccggcagaggagcccatggagcaggag
cctgccctgtga

DBGET integrated database retrieval system