KEGG   Pongo abelii (Sumatran orangutan): 100440790Help
Entry
100440790         CDS       T01416                                 

Gene name
ADPRH
Definition
(RefSeq) ADP-ribosylarginine hydrolase
  KO
K01245  ADP-ribosylarginine hydrolase [EC:3.2.2.19]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
KEGG Orthology (KO) [BR:pon00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100440790 (ADPRH)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.19  [protein ADP-ribosylarginine] hydrolase
     100440790 (ADPRH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADP_ribosyl_GH c-SKI_SMAD_bind
Motif
Other DBs
NCBI-GeneID: 100440790
NCBI-ProteinID: XP_002813294
Ensembl: ENSPPYG00000013513
UniProt: H2P9M7
LinkDB All DBs
Position
3
AA seq 357 aa AA seqDB search
MEKYVAAMVLSAAGDALGYYNGKWEFLQDGEKIHRQLAQLGGLDALDVGRWRVSDDTVMH
LATAEALVEAGKAPKLTRLYYLLAKHYQDCMEDMDGRAPGSASVHNTMQLKPGKPNGWRI
PFNSHEGGCGAAMRAMCIGLRFPHHSQLDTLIQVSIESGRMTHHHPTGYLGALASALFTA
YAVNARPPLQWGKGLMELLPEAKKYIVQSGYFVEENLQHWSYFQTKWENYLKLRGILDGE
SAPTFPEPFGVKERDQFYTSLSYSGWGGSSGHDAPMIAYDAVLAAGDSWKELAHRAFFHG
GDSDSTAAIAGCWWGVMYGFKGVSPSNYEKLEYRNRLEETARALYSLGSKEDTVISL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggagaagtatgtggctgctatggtgctgagtgcagctggagatgccctggggtactac
aatgggaagtgggagttcctccaggatggggagaagatacaccggcagttggcccagctg
ggcggcttggatgccctagacgtgggaaggtggagagttagtgacgacacagtgatgcac
ttggccacagcagaagctcttgtggaagctgggaaagcccctaagttgactcgactgtat
tacctccttgctaagcattaccaagactgcatggaagacatggatgggcgggcaccaggt
agtgcctcggtgcacaacaccatgcagctgaagcctggcaagcccaatggctggaggatt
cccttcaacagccatgagggtggctgtggggctgccatgcgggccatgtgcattggtctc
aggttcccacaccatagccaactggacacactgatccaagtgagcatcgagagtggtcgg
atgacccaccaccacccaacaggctacctgggggcccttgcgtctgctctttttacagcc
tatgctgtgaatgccagaccacccttgcagtggggaaaaggactgatggagctgctacca
gaagctaaaaagtacattgtccaatcaggctactttgtagaggaaaatcttcaacactgg
tcctacttccaaaccaaatgggaaaattacctaaaacttagagggattttggatggagaa
tcagcccctaccttccctgagccttttggtgtgaaggagagggatcagttctacacctcc
ctgagctactctggctggggtggcagcagtgggcacgatgcccccatgattgcctacgat
gccgttcttgctgcaggagactcctggaaggagcttgcccaccgagcctttttccatggt
ggagacagtgactctacagctgccattgctggctgctggtggggagttatgtacggtttt
aaaggagtgagtccctccaactatgagaaactagaatacagaaaccggctggaagagaca
gctagggctttatattctctcgggtcaaaagaagacactgtaatttccctttag

DBGET integrated database retrieval system