KEGG   Pongo abelii (Sumatran orangutan): 100440874
Entry
100440874         CDS       T01416                                 

Gene name
THEM4
Definition
(RefSeq) acyl-coenzyme A thioesterase THEM4 isoform X1
  KO
K16339  acyl-coenzyme A thioesterase THEM4 [EC:3.1.2.2]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00062  Fatty acid elongation
pon04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    100440874 (THEM4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100440874 (THEM4)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.2  palmitoyl-CoA hydrolase
     100440874 (THEM4)
SSDB
Motif
Pfam: 4HBT DUF2574
Other DBs
NCBI-GeneID: 100440874
NCBI-ProteinID: XP_009242572
Ensembl: ENSPPYG00000000851
UniProt: A0A663D7E7 H2N5T8
LinkDB
Position
1
AA seq 240 aa
MLRSCAARFRTLGALCRPPVGRRLPGSEPRPALRSFSSEEVILKDYSVPNTSWNKDLRLL
FDQFMKKCEDGSWKRLPSYKRTPTERIQDFKTRFLDPKLMKEEQMSQAQLFTRSFDDGLG
FEYVMFYNDVEKRMVCLFQGGPYLEGPPGFIHGGAIATMIDATVGMCAMMAGGIVMTANL
NINYKRPIPLCSVVMINSQLDKVEGRKFFVSCNVQSVDEKTLYSEATSLFIKLNPAKSLT
NT seq 723 nt   +upstreamnt  +downstreamnt
atgctgaggagctgcgccgcgcgcttccgcacgctgggggcactgtgccggccgccggta
ggccggcgcctgccgggtagcgagccgcgacctgcgctgaggtcattttcttctgaggaa
gtcattcttaaggactattctgtccccaacaccagctggaacaaggacctaagactgctc
tttgaccagtttatgaagaaatgtgaagatggctcctggaaacgtttgccttcatataaa
cgtacacctactgaaaggattcaagacttcaaaacccgttttcttgacccaaagcttatg
aaagaagaacaaatgtcacaggcccagctcttcaccagaagctttgatgatggcctaggc
tttgaatacgtgatgttctacaatgacgttgagaaaaggatggtttgcttatttcaagga
ggcccttacctggaaggaccacctggattcattcatggaggtgccattgcaactatgatt
gatgctactgttggtatgtgtgcaatgatggctgggggaattgtcatgactgccaatctc
aacatcaattataaaagacctatccctctttgttctgttgttatgataaatagccaactt
gataaagttgaaggaaggaaattttttgtttcctgtaatgttcagagtgttgatgagaag
accctatactcagaggcgacaagcttatttataaagctgaatcctgctaaaagtctgaca
taa

DBGET integrated database retrieval system