KEGG   Pongo abelii (Sumatran orangutan): 100441280
Entry
100441280         CDS       T01416                                 

Gene name
IRF3
Definition
(RefSeq) interferon regulatory factor 3 isoform X1
  KO
K05411  interferon regulatory factor 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04623  Cytosolic DNA-sensing pathway
pon05133  Pertussis
pon05135  Yersinia infection
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100441280 (IRF3)
   04621 NOD-like receptor signaling pathway
    100441280 (IRF3)
   04622 RIG-I-like receptor signaling pathway
    100441280 (IRF3)
   04623 Cytosolic DNA-sensing pathway
    100441280 (IRF3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100441280 (IRF3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100441280 (IRF3)
   05133 Pertussis
    100441280 (IRF3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100441280 (IRF3)
   05161 Hepatitis B
    100441280 (IRF3)
   05160 Hepatitis C
    100441280 (IRF3)
   05171 Coronavirus disease - COVID-19
    100441280 (IRF3)
   05164 Influenza A
    100441280 (IRF3)
   05162 Measles
    100441280 (IRF3)
   05168 Herpes simplex virus 1 infection
    100441280 (IRF3)
   05163 Human cytomegalovirus infection
    100441280 (IRF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100441280 (IRF3)
   05169 Epstein-Barr virus infection
    100441280 (IRF3)
   05165 Human papillomavirus infection
    100441280 (IRF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100441280 (IRF3)
   04131 Membrane trafficking [BR:pon04131]
    100441280 (IRF3)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    100441280 (IRF3)
Membrane trafficking [BR:pon04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    100441280 (IRF3)
SSDB
Motif
Pfam: IRF IRF-3
Other DBs
NCBI-GeneID: 100441280
NCBI-ProteinID: XP_009231173
Ensembl: ENSPPYG00000010260
LinkDB
Position
19
AA seq 490 aa
MFREIFCRGTVEGGLHWGRTMGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKH
GLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDP
HDPHKIYEFVNSGLPDWGSCGRLGPQGFLARLLPSPPFSTGVGDFSQPDTSPDTNGGGST
SDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPQQSPSLDNPTPFPNLGPSENPL
KRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPITLPDPGVSL
TDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELLPNSGHGPDGEVP
KDKEGGVFDLGPFIVGSWAPRSDYLHGRKRTLTTLCPLVLCWGVMAPGPAVDQEACDGQG
CAHVPQGLGRNRPGRGCLLPGEHCGPAHFQQPPTLPHLRPVQGLPAGLGGGHGFPGPWGG
LSPRSSWCGL
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgtttcgggagatcttctgtagggggactgtggaagggggtctacactggggccggacc
atgggaaccccaaagccacggatcctgccctggctggtgtcgcagctggacctggggcaa
ctggagggcgtggcctgggtgaacaagagccgcacgcgcttccgcatcccttggaagcac
ggcctacggcaggatgcacagcaggaggatttcggaatcttccaggcctgggccgaggcc
actggtgcatacgttcccgggagggataagccagacctgccaacctggaagaggaatttc
cgttctgccctcaaccgcaaagaaggcttgcgtttagcagaggaccggagcaaggaccct
catgacccacacaaaatctacgagtttgtgaactcaggtctgccagattggggttcgtgt
gggaggctggggccccaagggttcctggcacgcctactcccctcaccacctttctcaaca
ggagttggggacttttcccagccagacacctctccagacaccaatggcggaggcagtact
tctgatacccaggaagacattctggatgagttactgggtaacatggtgttggccccactc
ccagatccgggacccccaagcctggctgtagcccctgagccctgccctcagccccagcag
agccccagcttggacaatcccactcccttcccaaacttggggccctctgagaacccactg
aagcggctgttggtgccgggggaagagtgggagtttgaggtgacagccttctaccggggc
cgccaagtcttccagcagaccatctcctgcccagagggcctgcggctggtggggtccgaa
gtgggagacaggacgctgcctggatggccaatcacactgccagaccctggcgtgtccctg
acagacaggggagtgatgagctacgtgaggcatgtgctgagctgcctgggtgggggactg
gctctctggcgggctgggcagtggctctgggcccagcggctggggcactgccacacatac
tgggcagtgagcgaggagctcctccccaacagcgggcatgggcctgacggtgaggtcccc
aaggacaaggaaggaggcgtgttcgacctggggcccttcattgtaggctcctgggccccc
agatctgattaccttcacggaaggaagcggacgctcaccacgctatgccctctggttctg
tgttggggagtcatggccccaggaccagccgtggaccaagaggcttgtgatggtcaaggt
tgtgcccacgtgcctcagggccttggtagaaatcgcccgggtagggggtgcctcctccct
ggagaacactgtggacctgcacatttccaacagccacccactctccctcacctccgacca
gtacaaggcctacctgcaggacttggtggagggcatggatttccagggccctggggaggc
ctgagccctcgctcctcatggtgtggcctctaa

DBGET integrated database retrieval system