KEGG   Pongo abelii (Sumatran orangutan): 100441604
Entry
100441604         CDS       T01416                                 

Gene name
SELE
Definition
(RefSeq) E-selectin
  KO
K06494  selectin, endothelial cell
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04514  Cell adhesion molecules
pon04668  TNF signaling pathway
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05143  African trypanosomiasis
pon05144  Malaria
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100441604 (SELE)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    100441604 (SELE)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100441604 (SELE)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100441604 (SELE)
  09174 Infectious disease: parasitic
   05144 Malaria
    100441604 (SELE)
   05143 African trypanosomiasis
    100441604 (SELE)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:pon04515]
    100441604 (SELE)
   04090 CD molecules [BR:pon04090]
    100441604 (SELE)
   04091 Lectins [BR:pon04091]
    100441604 (SELE)
Cell adhesion molecules [BR:pon04515]
 Selectins
  Selectin family
   100441604 (SELE)
CD molecules [BR:pon04090]
 Proteins
  100441604 (SELE)
Lectins [BR:pon04091]
 C-Type lectins
  Group 4: Selectins
   100441604 (SELE)
SSDB
Motif
Pfam: Sushi Lectin_C EGF hEGF EGF_2 Plasmod_Pvs28
Other DBs
NCBI-GeneID: 100441604
NCBI-ProteinID: XP_024110079
Ensembl: ENSPPYG00000000528
LinkDB
Position
1
AA seq 610 aa
MIASQFLSALTLVLLVKESGAWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLN
SILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREK
DVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNC
TALESPEHGSLVCSHPLGNFSYNSSCSVSCDRGYLPSSMETMQCMSSGEWSAPVPACNVV
ECDAVTNPANGFVQCFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPMCK
AVTCRAIRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIP
VCEAFQCTALSNPERGYMNCLPSASGSFRNGSSCEFSCEQGFVLKGSKRLQCGPTGEWDN
EKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQ
WTEEVPSCQVVKCSSLAVLGKINMSCSGEPVFGTVCKFACPEGWMLNGSAALTCGATGHW
SGMLPTCEAPTESNIPLVAGLSAAGLSLLTLAPFLLWLRKCFRKAKKFVPASSCQSLESD
GSYQKPSYIL
NT seq 1833 nt   +upstreamnt  +downstreamnt
atgattgcttcacagtttctctcagctctcactttggtgcttctcgttaaagagagtgga
gcctggtcttacaacacctccacagaagctatgacttatgatgaggccagtgcttattgt
cagcaaaggtacacgcatctggttgcaattcaaaacaaagaagagattgagtacctaaac
tccatattgagctattcaccaagttattactggattggaatcagaaaagtcaacaatgtg
tgggtctgggtaggaacccagaaacctctgacggaagaagccaagaactgggctccaggt
gaacccaacaataggcaaaaagatgaggactgtgtggagatctacatcaagagagaaaaa
gatgtgggcatgtggaatgatgagaggtgcagcaagaagaagcttgccctatgctacaca
gctgcctgtaccaatacatcctgcagtggccacggtgaatgtgtggagaccatcaataat
tacacttgcaagtgtgaccctggcttcagtggactcaagtgtgagcaaattgtgaactgt
acagccctggaatcccctgagcatggaagcctggtttgcagtcacccactgggaaacttc
agctacaattcttcctgctctgtcagctgtgataggggctacctgccaagcagcatggag
accatgcagtgtatgtcctctggagaatggagtgctcctgttccagcctgcaatgtggtt
gagtgtgatgctgtgacaaacccagccaatgggttcgtgcaatgtttccaaaaccctgga
agcttcccatggaacacaacctgtacatttgactgtgaagaaggatttgaactaatggga
gcccagagccttcagtgtacctcatctgggaattgggacaacgagaagccaatgtgtaaa
gctgtgacatgcagggccatccgccagcctcagaatggctctgtgaggtgcagccattcc
cctgctggagagttcaccttcaaatcatcctgcaacttcacctgtgaggaaggcttcatg
ttgcagggaccagcccaggttgaatgcaccactcaagggcagtggacacagcaaatccca
gtctgtgaagctttccagtgcacagccttgtccaaccccgagcgaggctacatgaattgt
cttcctagtgcttctggaagtttccgtaatgggtccagctgtgagttctcctgtgagcag
ggttttgtgttgaagggatccaaaaggctccaatgtggccccacaggggagtgggacaac
gagaagcccacatgtgaagctgtgagatgcgatgctgtccaccagcccccgaagggtttg
gtgaggtgtgctcattcccctattggagaattcacctacaagtcctcttgtgccttcagc
tgtgaggagggatttgaattacatggatcaactcaacttgagtgcacatctcagggacaa
tggacagaagaggttccttcctgccaagtggtaaaatgttcaagcctggcagttctggga
aagatcaacatgagctgcagtggggagcccgtgtttggcactgtgtgcaagttcgcctgt
cctgaaggatggatgctcaatggctctgcagctctgacatgtggtgccacaggacactgg
tctggcatgctacctacctgtgaagctcccactgagtccaacattcccttggtagctgga
ctttctgctgctggactctccctcctgacattagcaccatttctcctctggcttcggaaa
tgctttcggaaagcaaagaaatttgttcctgccagcagctgccaaagccttgaatcagac
ggaagctaccaaaagccttcttacatcctttaa

DBGET integrated database retrieval system