KEGG   Pongo abelii (Sumatran orangutan): 100441699
Entry
100441699         CDS       T01416                                 

Gene name
TLN1
Definition
(RefSeq) talin-1
  KO
K06271  talin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04510  Focal adhesion
pon04611  Platelet activation
pon05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100441699 (TLN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100441699 (TLN1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100441699 (TLN1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100441699 (TLN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100441699 (TLN1)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100441699 (TLN1)
  Exosomal proteins of other cancer cells
   100441699 (TLN1)
SSDB
Motif
Pfam: I_LWEQ VBS Talin_middle FERM_f0 FERM_M FERM_N ACBP IRS DUF1013 RA DUF3025
Other DBs
NCBI-GeneID: 100441699
NCBI-ProteinID: XP_002819691
Ensembl: ENSPPYG00000019088
LinkDB
Position
9
AA seq 2541 aa
MVALSLKISIGNVVKTMQFEPSTMVYDACRIIRERIPEAPAGPPSDFGLFLSDDDPKKGI
WLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIG
ITNHDEYSLVRELMEEKKEEVTGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTL
REQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAG
FQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVK
LARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRWA
ASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTML
EDSVSPKKSTVLQQQYNRVGKVEHGSVALPAIMRSGASGPENFQVGSMPPAQQQITSGQM
HRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFDTLPPLGQDAASKAWRKNKMDESK
HEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEMSRGVKLLAALLED
EGGSGRPLLQAAKGLAGAVSELLRSAQPASAEPRQNLLQAAGNVGQASGELLQQIGESDT
DPHFQDVLMQLAKAVASAAAALVLKAKSVAQRTEDSGLQTQVIAAATQCALSTSQLVACT
KVVAPTISSPVCQEQLVEAGRLVAKAVESCVSASQAATEDGQLLRGVGAAATAVTQALNE
LLQHVKAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAI
KADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMA
TNAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAAQHAASTPKASAGPQPLLVQSCKAVA
EQIPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGKMVAAAKASVPTIQDQASAMQL
SQCAKNLGTALAELRTAAQKAQEACGPLEMDSALSVVQNLEKDLQEVKAAARDGKLKPLP
GETMEKCTQDLGNSTKAVSSAIAQLLGEVAQGNENYAGIAARDVAGGLRSLAQAARGVAA
LTSDPAVQAIVLDTASDVLDKASSLIEEAKKAAGHPGDPESQQRLAQVAKAVTQALNRCV
SCLPGQRDVDNALRAVGDASKRLLSDSLPPSTGTFQEAQSRLNEAAAGLNQAATELVQAS
RGTPQDLARASGRFGQDFSTFLEAGVEMAGQAPSQEDQAQVVSNLKGISMSSSKLLLAAK
ALSTDPAAPNLKSQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRELETVRELLENP
VQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGDAISTASKALCGFTEAA
AQAAYLVGVSDPNSQAGQQGLVEPTQFARANQAIQMACQSLGEPGCTQAQVLSAATIVAK
HTSALCNSCRLASARTTNPTAKRQFVQSAKEVANSTANLVKTIKALDGAFTEENRAQCRA
ATAPLLEAVDNLSAFASNPEFSSIPAQISPEGRAAMEPIVISAKTMLESAGGLIQTARAL
AVNPRDPPSWSVLAGHSRTVSDSIKKLITSMRDKAPGQLECETAIAALNSCLRDLDQASL
AAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLANAARAEASQLGHKVSQMAQYFEP
LTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAGGNPKQAAHTQEALEEAV
QMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGEPEGSFVDYQTTMVRT
AKAIAVTVQEMVTKSNTSPEELGPLANQLTSDYGRLASEAKPAAVAAENEEIGSHIKHRV
QELGHGCAALVTKAGALQCSPSDAYTKKELIECARRVSEKVSHVLAALQAGNRGTQACIT
AASAVSGIIADLDTTIMFATAGTLNREGTETFADHREGILKTAKVLVEDTKVLVQNAAGS
QEKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDLISATKA
AAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEHIRQELAVF
CSPEPPAKTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLRACK
EAAYHPEVAPDVRLRALHYGRECANGYLELLDHVLLTLQKPSPELKQQLTGHSKRVAGSV
TELIQAAEAMKGTEWVDPEDPTVIAENELLGAAAAIEAAAKKLEQLKPRAKPKEADESLN
FEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANALDDGQWSQGLISAARMV
AAATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQAAG
NAVKRASDNLVKAAQKAAAFEEQENETVVVKEKMVGGIAQIIAAQEEMLRKERELEEARK
KLAQIRQQQYKFLPSELRDEH
NT seq 7626 nt   +upstreamnt  +downstreamnt
atggttgcactttcactgaagatcagcattgggaatgtggtgaagacgatgcagtttgag
ccgtctaccatggtgtacgacgcctgccgcatcattcgtgagcggatcccagaggccccg
gctggtcctcccagcgactttgggctctttctgtcagatgatgaccccaaaaaaggtata
tggctggaggctgggaaagctttggactactacatgctccgaaatggggacactatggag
tacaggaagaaacagagacccctgaagatccgtatgctggatggaactgtgaagacgatc
atggtggatgactctaagactgtcactgacatgctcatgaccatctgtgcccgcattggc
atcaccaaccatgatgaatattcattggttcgagagctgatggaagagaaaaaggaggaa
gtaacagggaccttaagaaaggacaagacattgctgcgagatgaaaagaagatggagaaa
ctaaagcagaaattgcacacagatgatgagttgaactggctggaccatggtcggacactg
agggagcagggtgtagaggagcacgagacactgctgctgcggaggaagttcttttactca
gaccagaatgtggattcccgggaccctgtacagctgaacctcctgtatgtgcaggcacga
gatgacatcctgaatggctcccaccctgtctcctttgacaaggcctgtgagtttgctggc
ttccaatgccagatccagtttgggccccacaatgagcagaagcacaaggctggattcctc
gacctgaaggacttcctgcccaaggagtatgtgaagcagaagggagagcgtaagatcttc
caggcacacaagaattgtgggcaaatgagtgagattgaggccaaggtccgctacgtgaag
ctagcccgttctctcaagacttacggtgtctccttcttcctggtgaaggaaaaaatgaaa
ggcaagaacaagctagtgcccaggcttctgggcatcaccaaggagtgtgtgatgcgagtg
gatgagaagaccaaggaagtgatccaagagtggaacctcaccaacatcaaacgctgggct
gcctctcccaaaagcttcaccctggattttggagattaccaagatggctattactcagta
cagacaactgaaggggagcagattgcacagctcattgctggctacatcgatatcatcctg
aagaagaaaaaaagcaaggatcactttgggctggaaggagatgaggagtctactatgctg
gaggactcagtgtcccccaaaaagtcaacagtcctgcagcagcagtacaaccgggtgggg
aaagtggagcatggctctgtggccctgcctgccatcatgcgctctggagcctctggtccc
gagaatttccaggtgggcagcatgccccctgcccagcagcagattaccagcggccagatg
caccgaggacacatgcctcctctgacttcggcccagcaggcactcactggaaccattaac
tccagcatgcaggccgtgcaggctgcccaggccaccctggatgactttgacactctgccg
cctcttggccaggatgctgcctctaaggcctggcgtaaaaacaagatggatgaatcaaag
catgagatccactctcaggtagatgccatcacagctggtactgcgtctgtggtgaacctg
acagcaggggaccctgctgagacagactataccgcagtgggctgtgcagtcaccacaatc
tcctccaacctgacggaaatgtcccgtggggtgaagctgctggctgccttgctggaggat
gaaggcggcagtggccggcccctgttgcaggcagcaaagggccttgcgggagcagtgtca
gaactgctgcgcagtgcccaaccagccagtgctgagccccgtcagaacctgctgcaagca
gctgggaacgtgggccaggccagtggggagctgttgcaacaaattggggaaagtgatact
gacccccacttccaggatgtgctaatgcagcttgccaaagctgtggcaagtgctgcagct
gccctggtcctcaaggccaagagtgtggcccagcggacagaggactcgggacttcagacc
caagttattgctgcagcaacacagtgtgccctgtccacttcccaactagtggcctgtact
aaggtggtggcacctacaatcagctcacctgtctgccaagagcaactggtggaggctgga
cgactggtagccaaagccgtggagagctgtgtgtctgcctcccaggcagctacagaggat
gggcaactgttgcgaggggtaggagcagcagccacggctgtcacccaggccctaaatgag
ctgctgcagcatgtgaaagcccatgccacaggggccgggcctgctggccgttacgaccag
gctactgacaccatcctaaccgtcactgagaacatctttagctccatgggtgatgctggg
gagatggtgcgacaggcccgcatcctggcccaagccacatctgacctagtcaatgccatc
aaggctgatgctgagggggaaagtgatctggagaactcccgcaagctcttaagtgctgcc
aagatcctagctgatgccacagccaagatggtagaggctgccaagggagcagccgcccac
cctgacagtgaggagcagcagcagcgactgcgggaggcagctgaggggctgcgcatggcc
accaatgcagctgcgcaaaatgccatcaagaaaaagctggtgcagcgcctggagcatgca
gccaagcaggctgcagcctcagccacacagaccatcgctgcagctcagcacgcagcctct
acccccaaggcctctgctggcccccagcccctgctggtgcagagctgcaaggcagtggca
gagcagattccactgctggtgcagggcgtccgaggaagccaagcccagcctgacagcccc
agcgctcagcttgccctcattgctgccagccagagcttcctgcagccaggtgggaagatg
gtggcagctgcaaaggcctctgtgccaacgattcaggaccaggcttcagccatgcagctg
agtcagtgtgccaagaacctgggcactgcgctggctgaactccggacggctgcccagaag
gctcaggaagcatgtggacctttggagatggattctgcactgagtgtggtacagaatcta
gagaaagatctacaggaagtgaaggcagcggctcgagatggcaagcttaaacccttacct
ggggagacaatggaaaagtgtacccaggacctcggcaacagcaccaaagccgtgagctca
gccatcgcccagctactgggagaggttgcccagggcaatgagaattatgcaggtattgca
gctcgggatgtggcaggtgggctgcgttcactggcccaggccgctaggggagtcgctgca
ctgacgtcagatcctgcagtgcaggccattgtacttgatacggccagtgatgtgctggac
aaggccagcagcctcattgaggaggcgaaaaaggcagctggccatccaggggaccctgag
agccagcagcggcttgcccaggtggctaaagcagtgacccaggctctgaaccgctgtgtc
agctgcctacctggccagcgcgatgtggataatgccctgagggcagttggagatgccagc
aagcgactcctgagtgactcgcttcctcctagcactgggacatttcaagaagctcagagc
cggttgaatgaagctgctgctgggctgaatcaggcagccacagaactggtgcaggcctct
cggggaacccctcaggacctggctcgagcctcaggccgatttggacaggacttcagcacc
ttcctggaagctggtgtggagatggcaggccaggctccgagccaggaggaccaagcccaa
gttgtgtccaacttgaagggcatctccatgtcttcaagcaaacttcttctggctgccaag
gccctgtccacggaccctgctgcccctaacctcaagagtcagctggctgcagctgccagg
gcagtaactgacagcatcaatcagctcatcactatgtgcacccagcaggcacccggccag
aaggagtgtgataacgccctgcgggaattggagacggtccgggaactcctggagaaccca
gtccagcccatcaatgacatgtcctactttggttgcctggacagtgtaatggagaactca
aaggtgctgggcgaggccatgactggcatctcccaaaatgccaagaatggaaacctgcca
gagtttggagatgccatttccacagcctcaaaggcactttgtggcttcaccgaggcagct
gcacaggctgcatatctggttggtgtctctgaccccaatagccaagctggacagcaaggg
ctagtggagcccacacagtttgcccgtgcaaaccaggcaattcagatggcctgccagagt
ttgggagagcctggctgtacccaggcccaggtgctctccgcagccaccattgtggctaaa
cacacctctgcactgtgtaacagctgtcgcctggcctctgcccgtaccaccaatcctacc
gccaagcgccagtttgtacagtcagccaaggaggtggccaacagcacagcgaatcttgtc
aagaccatcaaggcgctagatggggccttcacagaggagaaccgtgcccagtgccgagca
gcaacagcccctctgctggaggctgtggacaatctgagtgcctttgcgtccaaccctgag
ttctccagcattcctgcccagatcagccctgagggtcgggctgccatggagcccattgtg
atctctgccaagacaatgttagagagtgccgggggactcatccagacagcccgggccctc
gcagtcaatccccgggaccccccaagctggtcagtgctggccggccactcccgtactgtc
tcagactccatcaagaagctaattacaagcatgagggacaaggctccagggcagctggag
tgtgaaacggccattgcagctctgaacagttgtctacgggacctagaccaggcttccctc
gctgcagtcagccagcagcttgctccccgtgagggaatctctcaagaggccttgcacact
cagatgctcactgcagtacaagagatctcccatctcattgagccgctggccaatgctgcc
cgggctgaagcctcccagctgggacacaaggtgtcccagatggcccagtactttgagccg
ctcaccctggctgcagtgggtgctgcctccaagaccctgagccacccgcagcagatggca
ctcctggaccagactaaaacattggcagagtctgccctgcagttgctatacactgccaag
gaggctggtggtaacccaaagcaagcagctcacacccaggaagccctggaggaggctgtg
cagatgatgacagaggccgtagaggacctgacaacaaccctcaacgaggcagccagtgct
gctggggtcgtgggtggcatggtggactccatcacccaggccatcaaccagctagatgaa
ggaccaatgggtgaaccagaaggttcctttgtggattaccagacaactatggtgcggaca
gccaaggccattgcagtgaccgttcaggagatggttaccaagtcaaacaccagcccggag
gagctgggccctcttgctaaccagctgaccagtgactatggccgtctggcctcggaggcc
aagcctgcagcggtggctgctgaaaatgaagagataggttcccatatcaaacaccgggta
caggagctgggccatggctgtgccgctctggtcaccaaggcaggcgccctgcagtgcagc
cccagtgatgcctacaccaagaaggagctcatagagtgtgcccggagagtctctgagaag
gtctcccacgtcctggctgcgctccaggctgggaatcgtggcacccaggcctgcatcaca
gcagccagcgctgtgtctggtattattgctgacctcgacaccaccatcatgttcgccact
gctggcacgctcaatcgcgagggtactgaaactttcgctgaccaccgggagggcatcctg
aagactgcgaaggtgctggtggaggacaccaaagtcctggtgcaaaacgcagctgggagc
caggagaagttggcgcaggctgcccagtcctccgtggcgaccatcacccgcctcgctgat
gtggtcaagctgggtgcagccagcctgggagctgaggaccctgagacccaggtggtacta
atcaacgcggtgaaagatgtagccaaggccctgggagacctcatcagtgcaacgaaggct
gcagctggcaaagttggagatgaccctgctgtgtggcagctaaagaactctgccaaggta
atggtgaccaatgtgacatcattgcttaaaacagtaaaagccgtggaagatgaggccacc
aaaggcactcgggccctggaggcaaccacagaacacatacggcaggaactggcggttttc
tgttccccagagccacctgctaagacctctaccccagaagacttcatccgaatgaccaag
ggtatcaccatggcaacagccaaggccgttgctgctggcaattcctgtcgccaggaagat
gtcattgccacagccaatctgagccgccgtgctattgcagatatgcttcgggcttgcaag
gaagcagcttaccacccagaagtggcccccgatgtgcggcttcgagccctgcactatggc
cgggaatgtgccaatggctacctggaactgctggaccatgtactgctgaccctgcagaag
ccaagcccagaactgaagcagcagttgacaggacattcaaagcgtgtggctggctccgtc
actgagctcatccaggctgctgaagccatgaagggaacagaatgggtagacccagaggac
cccacagtcattgctgagaatgagctcctgggagctgcagccgccattgaggctgcagcc
aaaaagctagagcagctgaagccccgggccaaacccaaggaggcagatgagtccttgaac
tttgaggagcagatactagaagctgccaagtccattgcagcagccaccagtgcactggta
aaggctgcgtcggctgcccagagagaactagtggcccaagggaaggtgggtgccattcca
gccaatgcactggacgatgggcagtggtcccagggcctcatttctgctgcccggatggtg
gctgcagccaccaacaatctgtgtgaggcagccaatgcagctgtacaaggccacgccagc
caggagaagctcatctcatcagccaagcaggtagctgcctccacagcccagctccttgtg
gcctgcaaggtcaaggctgaccaggactcggaggcaatgaaacgacttcaggctgctggc
aacgcagtgaagcgagcctcagataatctggtgaaagcagcacagaaggctgcagccttc
gaagaacaggagaatgagacagtggtggtgaaagagaagatggttggcggcattgcccag
atcatcgcagcacaggaagaaatgcttcggaaggaacgagagctggaagaggcgcggaag
aaactggcccagatccggcagcagcagtacaagtttctgccttcagagcttcgagatgag
cactaa

KEGG   Pongo abelii (Sumatran orangutan): 100451531
Entry
100451531         CDS       T01416                                 

Gene name
TLN2
Definition
(RefSeq) talin-2 isoform X1
  KO
K06271  talin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04510  Focal adhesion
pon04611  Platelet activation
pon05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100451531 (TLN2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100451531 (TLN2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100451531 (TLN2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100451531 (TLN2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100451531 (TLN2)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100451531 (TLN2)
  Exosomal proteins of other cancer cells
   100451531 (TLN2)
SSDB
Motif
Pfam: I_LWEQ VBS Talin_middle FERM_f0 FERM_M FERM_N IRS ACBP
Other DBs
NCBI-GeneID: 100451531
NCBI-ProteinID: XP_024088193
Ensembl: ENSPPYG00000006533
LinkDB
Position
15
AA seq 2542 aa
MVALSLKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDEDPRK
GIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSR
IGITNYEEYSLIQETIEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSR
TFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEF
GGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVK
YVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVK
RWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEES
TMLEESVSPKKSTILQQQFNRTGKAEHGSVALPAVMRSGSSGPETFNVGSMPSPQQQVMV
GQMHRGHMPPLTSAQQALMGTINTSMHAVQQAQDDLSELDSLPPLGQDMASRVWVQNKVD
ESKHEIHSQVDAITAGTASVVNLTAGDPADTDYTAVGCAITTISSNLTEMSKGVKLLAAL
MDDEVGSGEDLLRAARTLAGAVSDLLKAVQPTSGEPRQTVLTAAGSIGQASGDLLRQIGE
NETDERFQDVLMSLAKAVANAAAMLVLKAKNVAQVAEDTVLQNRVIAAATQCALSTSQLV
ACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAATTDSELLKQVSAAASVVSQA
LHDLLQHVRQFASRGEPIGRYDQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSDLV
NAMRSDAEAEIDMENSKKLLAAAKLLADSTARMVEAAKGAAANPENEDQQQRLREAAEGL
RVATNAAAQNAIKKKIVNRLEVAAKQAAAAATQTIAASQNAAVSNKNPAAQQQLVQSCKA
VADHIPQLVQGVRGSQAQAEDLSAQLALIISSQNFLQPGSKMVSSAKAAVPTVSDQAAAM
QLSQCAKNLATSLAELRTASQKAHEACGPMEIDSALNTVQTLKNELQDAKMAAVESQLKP
LPGETLEKCAQDLGSTSKAVGSSMAQLLTCAAQGNEHYTGVAARETAQALKTLAQAARGV
AASTTDPAATHAMLDSARDVMEGSTMLIQEAKQALIAPGDAESQQRLAQVAKAVSHSLNN
CVNCLPGQKDVDVALKSIGESSKKLLVDSLPPSTKPFQEAQSELNQAAADLNQSAGEVVH
ATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQIQVIGNLKNISMASSKLLLA
AKSLSVDPGAPNAKNLLAAAARAVTESINQLITLCTQQAPGQKECDNALRELETVKGMLD
NPNEPVSDLSYFDCIESVMENSKVLGESMAGISQNAKTGDLPAFGECVGIASKALCGLTE
AAAQAAYLVGISDPNSQAGHQGLVDPIQFARANQAIQMACQNLVDPGSSPSQVLSAATIV
AKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEDNRNKC
RIATAPLIEAVENLTAFASNPEFVSIPAQISSEGSQAQEPILVSAKTMLESSSYLIRTAR
SLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDYSIDGINQCIRDIEQA
SLAAVSQSLATRDDISVEALQEQLTSVVQEIGHLIDPIATAARGEAAQLGHKVTQLASYF
EPLILAAVGVASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEA
AQLMKEAVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEPKGTFVDYQTTVVK
YSKAIAVTAQEMMTKSVTNPEELGGLASQMTSDYGHLAFQGQMAAATAEPEEIGFQIRTR
VQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACI
TAATAVSGIIADLDTTIMFATAGTLNAENSETFADHRENILKTAKALVEDTKLLVSGAAS
TPDKLAQAAQSSAATITQLAEVVKLGAASLGSDDPETQVVLINAIKDVAKALSDLISATK
GAASKPADDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQELTV
FQSKDVPEKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVSDMLTAC
KQASFHADVSDEVRTRALRFGTECTLGYLDLLEHVLVILQKPTPELKQQLAAFSKRVAGA
VTELIQAAEAMKGTEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADETL
DFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGSIPANAADDGQWSQGLISAARM
VAAATSSLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQAA
GNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKFVGGIAQIIAAQEEMLKKERELEEARK
KLAQIRQQQYKFLPTELREDEG
NT seq 7629 nt   +upstreamnt  +downstreamnt
atggtggccctgtccttaaagatttgtgtgcgccactgcaacgtggtgaagaccatgcag
tttgaaccatctacagctgtgtacgatgcgtgtcgagtcattcgggaacgggtgcctgag
gcacaaactgggcaagcttctgactatggattgtttctttcggatgaagaccccaggaaa
gggatttggctggaagcgggcagaacactggattactacatgttgcggaatggggatatt
ttggaatataaaaagaaacagagacctcagaaaatccggatgctggatggatctgtgaag
acagtgatggtggatgattccaagactgtgggggagctcctggtcactatttgtagcaga
ataggaataacaaattatgaagaatactccttaatccaagaaactattgaagaaaagaaa
gaggaaggaacaggcacactcaaaaaagacaggacactgttacgagatgagaggaaaatg
gagaagttgaaggctaagctgcacacagatgatgacctaaattggctggatcacagccga
acattcagagaacaaggagtagatgaaaacgaaacgttgctgcttagacggaagttcttt
tactctgatcagaatgtagattcgagagaccccgtgcagctgaacttgctttatgttcag
gctcgggatgacatcctgaatggctctcaccctgtctccttcgagaaagcttgtgagttt
ggtggatttcaagcccagatacaatttggacctcatgtggaacataaacacaaacctgga
tttttagatctgaaggaattcctgcccaaagaatatatcaagcagagaggagctgaaaag
aggatctttcaggagcacaagaactgcggagagatgagtgagatagaagccaaggtcaag
tacgtcaaactcgcacggtccctccgcacatacggcgtgtccttcttcctggtgaaggaa
aagatgaaaggcaagaacaagctggtgccgcgcctgctggggatcaccaaagactcagtg
atgcgcgtggatgagaagaccaaggaagtgctgcaggagtggcccctcaccaccgtcaag
cgctgggcagcctcacccaagagcttcacactggattttggggagtatcaggaaagctac
tattcagtacaaaccaccgagggagagcagatatcccagctgattgcaggctacattgac
atcatcctgaaaaagaaacaaagtaaagatcgatttggactagaaggtgatgaggagtca
accatgttagaagagtccgtttccccaaaaaagtccaccatcttgcagcagcagttcaac
cggaccgggaaggcagagcacggctcagtggcgctgccggccgtgatgcgctcgggctcc
agcgggcctgagaccttcaacgttggcagcatgccctcgccacagcagcaggtcatggtt
gggcagatgcaccgaggccacatgccgccactgacctcagcccagcaggccctgatgggg
accatcaacacaagcatgcacgccgtccagcaggcccaggatgatctcagtgagctcgac
tcgctgccacctctcggccaggatatggcatctagggtatgggttcagaacaaagtcgac
gaatccaaacacgaaatccattctcaagttgatgctatcacagctggaacggcttcagtt
gttaacctcacagctggtgaccctgcagacactgactacacagctgtgggatgtgcgatc
accactatttcttccaacctgacggagatgtccaagggtgtgaagctattggccgccctc
atggatgatgaggtgggcagcggggaggacttgctcagagctgccaggacccttgctggg
gcagtgtcagacttgctgaaagctgtgcagcccacttctggagagcctcgacagacagtt
ttgactgctgctggcagcatcggacaagccagtggggatcttctgagacagattggagag
aatgagaccgatgagcgattccaggatgttttaatgagtttggccaaagctgttgccaat
gcagctgccatgttggtactaaaggcaaagaatgttgcccaagtggccgaagacactgtc
ctacagaacagggtaattgctgctgccacccagtgtgccctctccacctcccagcttgtg
gcatgtgccaaggttgtgagccccactattagctcccctgtgtgccaggagcagctgatt
gaagcagggaagctggtggaccgctcagtggagaactgcgtccgtgcctgccaggcagcc
actaccgatagtgagctcctgaagcaggtcagcgcagcggccagcgtggtcagccaggcc
ctccatgatctcctgcagcatgtgcggcagtttgccagccgaggcgagcccatcggccgc
tacgaccaggctaccgacaccatcatgtgtgtcaccgagagcatcttcagctccatgggt
gatgctggtgaaatggtgcgccaggcacgggtcctggcccaagccacatcagacctcgtc
aatgccatgaggtcagatgcagaagctgaaatcgacatggagaattcaaagaagctcctg
gcagcagcaaaactcttagctgactccactgctcgcatggtggaagctgcaaagggggct
gcagccaacccggagaatgaggaccagcagcaaaggctgagagaagctgcagaaggcctc
cgggtagcaaccaacgcagctgcccagaatgctattaagaaaaaaattgtcaaccgactg
gaggttgcagccaagcaggccgcagcggcagccacacagaccatcgccgcctcccagaat
gcagctgtttccaacaagaaccctgcagcccagcagcagctggtccagagttgcaaggca
gtggctgatcacatccctcagctggtccagggagtgagggggagccaagctcaagctgaa
gacctgagtgcccagctggctctcatcatctccagccagaacttcctccagcctggaagc
aagatggtgtcctctgccaaagccgcagtgcccactgtgagtgaccaggctgcagccatg
cagctgagccagtgtgccaagaacctggccaccagcttggcggagctgcgtaccgcctcg
cagaaggcccatgaagcctgtggtccaatggaaatcgattctgctctgaatacggtgcag
acgcttaagaatgaactgcaggatgccaagatggcggctgtggagagccagctgaagcca
cttccaggggaaacgctggaaaaatgtgctcaggacctgggaagcacatccaaggcagtg
ggctcctccatggcacagctgctgacctgtgctgctcaaggcaacgaacactacacaggg
gtggctgctagagagacggcccaagctctgaaaacactggcccaggccgcccgtggagtg
gctgcatcgacaaccgaccccgcggccacccatgccatgttagattctgctcgagatgtg
atggagggctccaccatgctcattcaagaggccaagcaggccctgattgcacctggagat
gcagagagtcaacaaagactggctcaggtggctaaagccgtctcacactccttgaataac
tgcgtaaattgcctccctgggcagaaggatgtggacgtggccttgaagagcatcggggag
tccagcaagaagttgcttgtggattcgctacctccaagcacgaagcctttccaggaagcc
cagagtgaactgaaccaggcagcagctgatctgaaccagtctgctggggaagtggtccat
gccacccggggccagagtggagagttggctgcagcctctggaaagttcagtgatgatttt
gatgaattcctcgatgctggcattgagatggctggccaagctcagacaaaagaagaccag
atccaagtgatagggaacctcaagaatatctcgatggcatccagcaagctgctgttagct
gccaagtctctctctgtagatccaggagctcccaatgcgaaaaatctcctggctgctgct
gcaagagctgtgacagagagcatcaatcaactcatcactctgtgtacccaacaagctccg
ggccagaaagagtgcgataatgccctccgggagctcgagactgtgaagggaatgttggac
aatcctaatgaacctgttagtgacctctcttactttgactgcattgagagtgtgatggaa
aactccaaggttctgggtgaatcgatggcagggatttcacagaatgccaagaccggagac
ctccctgcctttggggaatgtgtggggattgcatccaaggctctctgtgggctgacagag
gctgcagcccaggctgcatacttggttggcatctctgatccaaacagccaggcaggccac
cagggcctagtggaccccatccagtttgctagggctaaccaggccatccagatggcatgc
cagaacttggtggaccctggcagcagcccatcacaggtcctgtcagctgccacaattgtt
gccaagcacacgtcagccttgtgcaatgcctgccgcatcgcctcatccaagacggccaac
ccagtagccaagaggcactttgtccagtcagccaaggaagtcgccaacagcactgccaac
ctggtgaagaccatcaaggccctggatggggatttctctgaagacaaccgcaataagtgt
cgcattgccaccgcacccttgattgaagctgtggagaacctgacagcgttcgcctcaaac
cctgagtttgtcagcattcccgcccagatcagctctgagggttcccaggcacaggaacca
atcctggtctcggccaagaccatgctggagagttcatcgtacctcattcgcactgcacgc
tctctggccatcaaccccaaagacccacccacctggtctgtactggctggacattcccat
acagtgtccgactccatcaagagtctcatcacttctatcagggacaaggcccctggacag
agggagtgtgattactccatcgatggcatcaaccagtgcatccgggacatcgagcaggcc
tcgctggccgccgtcagccaaagcctggccacgagggacgacatctctgtggaggccctg
caggagcagctgacttcggtggtccaggaaatcggacaccttatcgatcccatcgccaca
gcggctcggggagaagcagctcagctgggacataaggtgacacaactggcaagctatttt
gagcccttgatcttagccgcggtcggtgtggcctccaagattcttgatcatcagcagcag
atgacggtgctggaccagaccaagactctcgcagagtctgccttgcagatgttgtatgca
gccaaagaaggtggcggaaaccccaaggcgcaacacacccatgacgccatcacagaggcc
gcccagttgatgaaggaagccgtggacgacatcatggtgacgctgaacgaagctgccagt
gaagtggggctggttgggggcatggtggacgccattgcagaagccatgagcaagctggat
gaaggcactcctccagaaccaaagggaacatttgtcgactatcagacgactgtggttaaa
tactccaaagccattgcggtgacagctcaggaaatgatgactaagtcggttactaacccg
gaggagttgggaggactggcttcacaaatgaccagtgactatgggcacctggctttccag
ggccagatggcagcagccacggcggaaccagaggagattggattccagattcgcactcgt
gtgcaggacctgggccacggctgtatcttcctggtgcagaaggcaggggccctccaggtc
tgccccacagacagctacaccaagagggagctgatcgaatgcgcccgtgccgtcacggag
aaggtctccttggtgctctcagctctccaggccgggaacaaaggaacccaggcatgcatt
acagccgccaccgctgtgtctgggatcattgccgacctggacaccaccattatgtttgca
acagcggggacactgaatgcagagaacagtgagaccttcgcagaccacagggagaacatt
ctcaagacagccaaggccttggtagaagacacgaaactacttgtgtcaggagctgcgtcc
actcctgacaagctggcccaggcggcccagtcctcagcagccaccatcacccagctcgca
gaagtggtcaagctgggggcagccagcctgggctccgacgaccccgagacccaggtggtt
ttgatcaatgccatcaaagatgtggccaaggccctttccgatctcatcagtgctaccaag
ggagctgccagcaagccagcggacgacccttccatgtaccagctcaagggggccgccaag
gtgatggtgaccaatgtcacctccctcctcaagactgtaaaggcagtggaggacgaggcc
acccggggcaccagggcgcttgaggccacgattgaatgcataaagcaggagcttacggtg
ttccagtcaaaagacgtacctgaaaagacatcatcacctgaagaatccataaggatgacg
aaaggcatcaccatggcaacagccaaagccgtggcagctgggaactcatgtagacaggag
gacgtgattgctactgccaacctgagccggaaagccgtgtcagatatgttgacggcttgc
aagcaagcatccttccatgccgatgtcagtgacgaggtgagaaccagagccttgcgtttc
gggacggagtgcaccctcggctacttggacctcctggagcacgtcttggtgattcttcag
aaaccaaccccagaactcaagcagcagctggccgctttctccaagcgagttgccggcgct
gtgacagagctcatccaggcagcggaggccatgaaaggaacagagtgggtggatccagaa
gacccaactgtcattgcagaaacagagttactgggggctgcagcatccatcgaagctgct
gctaagaagttagagcaactgaagccaagagcaaaaccaaaacaagcggatgagaccctg
gactttgaggaacagatcttggaagctgctaaatccattgctgctgccacaagcgccctg
gtcaaatcggcctcggcagcccagagggagctggtggcccaaggaaaggtgggctccatc
cctgccaatgctgccgacgacggacagtggtcacaggggctgatttctgctgcccggatg
gtggcggctgcgaccagcagtctctgtgaggcggccaatgcctccgttcagggacatgcc
agcgaggagaagctcatctcatctgccaagcaggtcgccgcttccacggctcagctgctg
gtggcctgcaaggtgaaggccgaccaggattcagaggccatgaggcggctacaggcggca
ggaaatgctgtgaaaagagcctcagacaatcttgtccgtgcagcccagaaggcagcattt
ggcaaagctgatgatgacgatgttgtagtgaaaaccaagtttgtggggggcattgctcag
atcatcgccgcccaggaggaaatgctaaagaaagagcgagaactggaagaagcaaggaaa
aaactggcccagatccgccagcagcagtataagtttttacccaccgagctgagggaagat
gagggttaa

DBGET integrated database retrieval system