KEGG   Pongo abelii (Sumatran orangutan): 100441708
Entry
100441708         CDS       T01416                                 

Gene name
ADRB1
Definition
(RefSeq) beta-1 adrenergic receptor
  KO
K04141  adrenergic receptor beta-1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04020  Calcium signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04080  Neuroactive ligand-receptor interaction
pon04261  Adrenergic signaling in cardiomyocytes
pon04540  Gap junction
pon04923  Regulation of lipolysis in adipocytes
pon04924  Renin secretion
pon04970  Salivary secretion
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100441708 (ADRB1)
   04024 cAMP signaling pathway
    100441708 (ADRB1)
   04022 cGMP-PKG signaling pathway
    100441708 (ADRB1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100441708 (ADRB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100441708 (ADRB1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    100441708 (ADRB1)
   04924 Renin secretion
    100441708 (ADRB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100441708 (ADRB1)
  09154 Digestive system
   04970 Salivary secretion
    100441708 (ADRB1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    100441708 (ADRB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pon04030]
    100441708 (ADRB1)
G protein-coupled receptors [BR:pon04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    100441708 (ADRB1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7TM_GPCR_Srx 7tm_4
Other DBs
NCBI-GeneID: 100441708
NCBI-ProteinID: XP_002821216
Ensembl: ENSPPYG00000002670
UniProt: H2NBN6
LinkDB
Position
10
AA seq 475 aa
MGAGALVLGASEPGNLSSAAPLPDGAATAARLLVPASPPASLLPPAGEGPEPLSQQWTAG
MGLLMALIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVV
WGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARGLVC
TVWAISALVSFLPILMHWWRAESDEARRCYNDPKCCDFVTNRAYAIASSVVSFYVPLCIM
AFVYLRVFREAQKQVKKIDSCERRFLGGPARPPSPSPVPAPAPPPGPQRPTAAAATAPLA
NGRAGKRRPSRLVALREQKALKTLGIIMGVFTLCWLPFFLANVVKAFHRELVPDRLFVFF
NWLGYANSAFNPIIYCRSPDFRKAFQRLLCWARRAARRRHATHGDRPRASGCLARPGPPP
SPGAASDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgggcgcgggggcgctcgtcctgggcgcctccgagcccggtaacctgtcgtcggccgca
ccgctccccgacggcgcggccaccgcggcgcggctgctggtgcccgcgtcgccgcccgcc
tcgttgctgcctcccgccggcgaaggccccgagccgctgtcgcagcagtggacagcgggc
atgggtctgctgatggcgctcatcgtgctgctcatcgtggcgggcaacgtgctggtgatc
gtggccatcgccaagacgccgcggctgcagacgctcaccaacctcttcatcatgtccctg
gccagcgccgacctggtcatggggctgctggtggtgccgttcggggccaccatcgtggta
tggggccgctgggagtacggctccttcttctgcgagctgtggacctcggtggacgtgctg
tgcgtgacggccagcatcgagaccctgtgtgtcattgccctggaccgctacctcgccatc
acctcgcccttccgctaccagagcctgctgacgcgcgcgcgggcgcggggcctcgtgtgc
accgtgtgggccatctcggccctggtgtcgttcctgcccattctcatgcactggtggcgg
gcggagagcgacgaggcgcgccgctgctacaacgaccccaagtgctgcgacttcgtcacc
aaccgggcctacgccatcgcctcgtccgtggtctccttctacgtgcccctgtgcatcatg
gccttcgtgtacctgcgggtgttccgcgaggcccagaagcaggtgaagaagatcgacagc
tgcgagcgccgtttcctcggcggccccgcgcggccgccctcgccctcgccagtccccgcg
cccgcgccgccacccggaccccagcgccccaccgccgccgccgccacagccccgctggcc
aacgggcgtgcgggtaagcggcggccctcgcgcctcgtggccctgcgcgagcagaaggcg
ctcaagacgctgggcatcatcatgggcgtcttcacgctctgctggctgcccttcttcctg
gccaacgtggtgaaggccttccaccgcgagctggtgccggaccgcctcttcgtcttcttc
aactggctgggctacgccaactcggccttcaaccccatcatctactgccgcagcccggac
ttccgcaaggccttccagcgactgctctgctgggcgcgcagggctgcccgccggcgccac
gcgacccacggagaccggccgcgcgcctcgggctgtctggcccggcccggccccccgccg
tcgcctggggccgcctcggacgacgacgacgacgatgtcgtcggggccacgccgcccgcg
cgcctgctggagccctgggccggctgcaacggcggggcggcggcggacagcgactcgagc
ctggacgagccgtgccgccccggcttcgcctcggaatccaaggtgtag

DBGET integrated database retrieval system