KEGG   Pongo abelii (Sumatran orangutan): 100441912
Entry
100441912         CDS       T01416                                 

Gene name
ESR1
Definition
(RefSeq) estrogen receptor isoform X2
  KO
K08550  estrogen receptor alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04915  Estrogen signaling pathway
pon04917  Prolactin signaling pathway
pon04919  Thyroid hormone signaling pathway
pon04961  Endocrine and other factor-regulated calcium reabsorption
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100441912 (ESR1)
   04917 Prolactin signaling pathway
    100441912 (ESR1)
   04919 Thyroid hormone signaling pathway
    100441912 (ESR1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100441912 (ESR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100441912 (ESR1)
   05205 Proteoglycans in cancer
    100441912 (ESR1)
  09162 Cancer: specific types
   05224 Breast cancer
    100441912 (ESR1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100441912 (ESR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100441912 (ESR1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:pon03310]
    100441912 (ESR1)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    100441912 (ESR1)
Nuclear receptors [BR:pon03310]
 3. Estrogen like
  3A. Estrogen receptor
   100441912 (ESR1)
SSDB
Motif
Pfam: Oest_recep Hormone_recep zf-C4 ESR1_C
Other DBs
NCBI-GeneID: 100441912
NCBI-ProteinID: XP_002817538
Ensembl: ENSPPYG00000017112
UniProt: A0A6D2XRP1 A0A2J8XAF0
LinkDB
Position
6
AA seq 595 aa
MIMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYVDSSKPAVYNYPEGAAY
EFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPF
LQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAK
ETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQAC
RLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKH
SKKNSPALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINW
AKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG
MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLD
KITDTLIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLL
LEMLDAHRLHAPTSRGGAPVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV
NT seq 1788 nt   +upstreamnt  +downstreamnt
atgatcatgaccctccacaccaaagcatccgggatggccctactgcatcagatccaaggg
aacgagctggagcccctgaaccgtccgcagctcaagatccccctggagcggcccctgggc
gaggtgtacgtggacagcagcaagcccgccgtgtacaactaccccgagggcgccgcctac
gagttcaacgccgcggccgccgccaacgcgcaggtctacggtcagaccggcctcccctac
ggccccgggtctgaggctgcggcgttcggctccaatggcctggggggtttccccccactc
aacagcgtgtctccgagcccgctgatgcttctgcacccgccgccgcagctgtcgcctttc
ctgcagccccacggccagcaggtgccctactacctggagaacgagcccagcggctacacg
gtgcgcgaggccggcccgccggcattctacaggccaaattcagataatcgacgccagggt
ggcagagaaagattggccagtaccaatgacaagggaagtatggctatggaatctgccaag
gagactcgctactgtgcagtgtgcaatgactatgcttcaggctaccattatggagtctgg
tcctgtgagggctgcaaggccttcttcaagagaagtattcaaggacataacgactatatg
tgtccagccaccaaccaatgcaccattgataaaaacaggaggaagagctgccaggcctgc
cggctccgcaaatgctacgaagtgggaatgatgaaaggtgggatacgaaaagaccgaaga
ggagggagaatgttgaaacacaagcgccagagagatgatggggagggcaggggtgaagtg
gggtctgctggagacatgagagctgccaacctttggccaagcccgctcatgatcaaacac
tctaagaagaacagcccggccttgtccctgacggccgaccagatggtcagtgccttgttg
gatgctgagccccccatactgtattccgagtatgatcctaccagacccttcagtgaggct
tcgatgatgggcttactgaccaacctggcagacagggagctggttcacatgatcaactgg
gcaaagagggtgccaggctttgtggatttgaccctccatgatcaggtccaccttctagaa
tgtgcctggctagagatcctgatgattggtctcgtctggcgctccatggagcacccaggg
aagctcctgtttgctcctaacttgctcttggacaggaaccagggaaaatgtgtagagggc
atggtggagatcttcgacatgctgctggctacatcatctcggttccgcatgatgaatctg
cagggagaggagtttgtgtgcctcaaatctattattttgcttaattctggagtgtacaca
tttctgtccagcaccctgaagtctctggaagagaaggaccatatccaccgagtcctggac
aagatcacagacactttgatccacctgatggccaaggcaggcctgaccctgcagcagcag
caccggcggctggcccagctcctcctcatcctctcccacatcaggcacatgagtaacaaa
ggcatggagcatctgtacagcatgaagtgcaagaacgtggtgcctctctatgacctgctg
ctagagatgctggacgcccaccgcctgcatgcgcccactagccgtggaggggcgcccgtg
gaggagacggaccaaagccacttggccaccgcgggctctacttcatcgcattccttgcaa
aagtattacatcacgggggaggcagagggtttccctgccacagtctga

KEGG   Pongo abelii (Sumatran orangutan): 100459579
Entry
100459579         CDS       T01416                                 

Gene name
ESR2
Definition
(RefSeq) estrogen receptor beta isoform X1
  KO
K08551  estrogen receptor beta
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04915  Estrogen signaling pathway
pon04917  Prolactin signaling pathway
pon04929  GnRH secretion
pon05200  Pathways in cancer
pon05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    100459579 (ESR2)
   04915 Estrogen signaling pathway
    100459579 (ESR2)
   04917 Prolactin signaling pathway
    100459579 (ESR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100459579 (ESR2)
  09162 Cancer: specific types
   05224 Breast cancer
    100459579 (ESR2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100459579 (ESR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100459579 (ESR2)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:pon03310]
    100459579 (ESR2)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    100459579 (ESR2)
Nuclear receptors [BR:pon03310]
 3. Estrogen like
  3A. Estrogen receptor
   100459579 (ESR2)
SSDB
Motif
Pfam: ERbeta_N Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 100459579
NCBI-ProteinID: XP_002824882
Ensembl: ENSPPYG00000005896
UniProt: H2NLH9
LinkDB
Position
14
AA seq 531 aa
MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVESHHEYPAMTFYSPAVMNYSIPS
NVTNLEGGGPGRQTTSPNVLWPTPGHLSPLAVHRQLSHLYAEPQKSPWCEARSLEHTLPV
NRETLKRKVSGNHCASPVTGPSSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQG
HNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQL
HCAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLT
KLADKELVHMISWAKKIPGFVELSLFDQVRLLESCWMEVLMVGLMWRSIDHPGKLIFAPD
LVLDRDEGKCVEGILEIFDMLLATTSRFRELKLQHKEYLCVKAMILLNSSMYPLVAATQD
ADSSRKLAHLLNAMTDALVWVIAKSGISSQQQSMRLANLLMLLSHVRHASNKGMEHLLSM
KCKNVVPVYDLLLEMLNAQVLRGCKSSITGSECSPAEDSRSKEGSQNPQSQ
NT seq 1596 nt   +upstreamnt  +downstreamnt
atggatataaaaaactcaccatctagccttaattctccttcctcctacaactgcagtcaa
tccatcttacccctggagcatggctccatatacataccttcttcctatgtagagagccac
catgaatatccagccatgacattctatagccctgctgtgatgaattacagcattcccagc
aatgtcactaacttggaaggtggtgggcctggtcggcagaccacaagcccaaatgtgttg
tggccaacacctgggcacctttctcctttagcggtccatcgccagttatcacatctgtat
gcagaacctcaaaagagtccctggtgtgaagcaagatcactagaacacaccttacctgta
aacagagagacactgaaaaggaaggttagtgggaaccattgcgccagtcctgttactggt
ccaagttcaaagagggacgctcacttctgcgctgtctgcagcgattacgcatcgggatat
cactatggagtctggtcgtgtgaaggatgtaaggccttttttaaaagaagcattcaagga
cataatgattatatttgtccagctacaaatcagtgtacaattgataaaaaccggcgcaag
agctgccaggcctgccgacttcggaagtgttacgaagtgggaatggtgaagtgtggctcc
cggagagagagatgtgggtaccgccttgtgcgaagacagagaagcgccgacgagcagctg
cactgtgccggcaaggccaagagaagtggcggccacgcgccccgagtgcgggagctgctg
ctggacgccctgagccccgagcagctggtgctcaccctcctggaggctgagccgccccat
gtgctgatcagccgccccagcgcgcccttcaccgaggcctccatgatgatgtccctgacc
aagttggccgacaaggagttggtacacatgatcagctgggccaagaagattcccggcttt
gtggagctcagcctgtttgaccaagtgcggctcttggagagctgttggatggaggtgtta
atggtggggctgatgtggcgctcaattgaccaccccggcaagcttatctttgctccagat
cttgttctggacagggatgaggggaaatgcgtagaaggaattctggaaatctttgacatg
ctcctggcaactacttcaaggtttcgagagttaaaactccaacacaaagagtatctctgt
gtcaaggccatgatcctgctcaattccagtatgtaccctctggtcgcagcgacccaggat
gctgacagcagccggaagctggcccacttgctgaacgccatgaccgatgctttggtctgg
gtgatcgccaagagcggcatctcctcccagcagcaatccatgcgcctggctaacctcctg
atgctcctgtcccatgtcaggcatgcgagtaacaagggcatggaacatctgctcagcatg
aagtgcaaaaacgtggtcccagtgtatgacctgctgctggagatgctgaatgcccaagtg
cttcgcgggtgcaagtcctccatcacggggtccgagtgcagcccagcagaggacagtaga
agcaaagagggctcccagaacccacagtctcagtga

DBGET integrated database retrieval system