KEGG   Pongo abelii (Sumatran orangutan): 100441930
Entry
100441930         CDS       T01416                                 

Gene name
SLC7A13
Definition
(RefSeq) solute carrier family 7 member 13 isoform X1
  KO
K13870  solute carrier family 7 (L-type amino acid transporter), member 12/13
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
KEGG Orthology (KO) [BR:pon00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100441930 (SLC7A13)
Transporters [BR:pon02000]
 Solute carrier family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   100441930 (SLC7A13)
SSDB
Motif
Pfam: AA_permease_2 AA_permease
Other DBs
NCBI-GeneID: 100441930
NCBI-ProteinID: XP_002819288
Ensembl: ENSPPYG00000018723
UniProt: H2PQQ7
LinkDB
Position
8
AA seq 483 aa
MDRGEKIQLKRVFGYCWGTSFLLINIIGAGIFVSPKGVLAYSCMNVGVSLCVWAGCAILA
MTSTLCSAEISISFPCSGAQYYFLKRYFGSTVAFLNLWTSLFLGSGVVAGQALLLAEYSI
QPFFPSCSVPKLPKKCLALAMLWIVGILTSRGVKEVTWLQIASSVLKVSILSFISLTGVV
FLIRGKKENVERFQNAFDAEFPDISHLIQAIFQGYFAYSGGACFTLIAGELKKPRTTIPK
CIFTALPLVTVVYLLVNISYLTVLTPREILSSDAVAITWADRVFPSLAWIMPFAISTSLF
SNLLISIFKSSRPIYLASQEGQLPLLFNTLNSHSSPFTAVLLLVTLGSLAIILTSLIDLI
NYIFFTNSLWSILLMIGILRRRYQEPNLSIPYKVFLPFPLATIVIDMGLVVIPLVKSPNV
HYVYVLLLVLSGLLFYIPLIHFKIRLAWFEKMTCYLQLLFNICLPDVSEEQMSEVQTLKK
MAF
NT seq 1452 nt   +upstreamnt  +downstreamnt
atggatagaggggagaaaatacagctcaagagagtgtttggatattgctggggcacaagt
tttttgcttattaatatcattggtgcaggaatttttgtgtcccccaaaggtgtgttggca
tactcttgcatgaacgtgggagtctccctgtgtgtttgggctggctgtgccatactggcc
atgacatcaactctttgctctgcagagataagtataagcttcccatgcagtggagctcaa
tactattttctcaagagatactttggctccacagttgcttttttgaatctttggacatcc
ttgtttctggggtcaggggtagttgctggccaagctctgctcctcgctgagtacagcatc
cagcctttttttcccagctgctctgtcccaaagctgcctaagaaatgtctggcattggcc
atgttgtggattgtaggaattctgacttctcgtggtgtgaaagaagtgacttggcttcag
atagctagctcagtgctgaaagtgtccatacttagcttcatttccctaactggagtagtg
ttcctgataagagggaaaaaggagaatgtagaacggtttcagaatgcttttgatgctgaa
tttccagatatctctcaccttatacaagccatcttccaaggatattttgcatattcaggc
ggggcatgctttacacttatagcaggggagctgaagaaacccagaacaacaattcccaaa
tgcatatttactgcgttacctctggtgactgtagtttatttactggttaacatttcctat
ctgactgttctgacacccagggaaattctctcttcagatgctgtagctatcacatgggct
gatcgagtttttccctcattagcatggattatgccttttgctatttctacctcattattt
agcaaccttctgatttctatatttaaatcatcgagaccaatatatcttgcaagccaagag
ggccagctgcctttgctatttaatacacttaatagtcactcctctccatttacagctgtg
ctactacttgtcactttgggatcccttgcaattatcttaacaagtctaattgatttgata
aactatatttttttcacgaattcattatggtctatattattaatgataggaatactaagg
cggagataccaggaacccaatctatctataccttataaggtgtttttgccgtttccatta
gcaacaatagtcatcgacatgggcttggttgtgataccgttggtaaagtctccaaatgtg
cattatgtctacgtgcttctgttagttctcagcggattactattttacatacctttaata
cattttaaaataagattggcttggtttgagaagatgacttgctatttacaattactattt
aatatttgcctccctgatgtgtctgaggaacagatgtcggaagtgcaaactcttaaaaaa
atggccttctaa

DBGET integrated database retrieval system