KEGG   Pongo abelii (Sumatran orangutan): 100442100
Entry
100442100         CDS       T01416                                 

Gene name
AKT1
Definition
(RefSeq) RAC-alpha serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon01524  Platinum drug resistance
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04071  Sphingolipid signaling pathway
pon04072  Phospholipase D signaling pathway
pon04140  Autophagy - animal
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04210  Apoptosis
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04218  Cellular senescence
pon04261  Adrenergic signaling in cardiomyocytes
pon04370  VEGF signaling pathway
pon04371  Apelin signaling pathway
pon04380  Osteoclast differentiation
pon04510  Focal adhesion
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04611  Platelet activation
pon04613  Neutrophil extracellular trap formation
pon04620  Toll-like receptor signaling pathway
pon04625  C-type lectin receptor signaling pathway
pon04630  JAK-STAT signaling pathway
pon04660  T cell receptor signaling pathway
pon04662  B cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04668  TNF signaling pathway
pon04722  Neurotrophin signaling pathway
pon04725  Cholinergic synapse
pon04728  Dopaminergic synapse
pon04910  Insulin signaling pathway
pon04914  Progesterone-mediated oocyte maturation
pon04915  Estrogen signaling pathway
pon04917  Prolactin signaling pathway
pon04919  Thyroid hormone signaling pathway
pon04920  Adipocytokine signaling pathway
pon04922  Glucagon signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04926  Relaxin signaling pathway
pon04929  GnRH secretion
pon04931  Insulin resistance
pon04932  Non-alcoholic fatty liver disease
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04935  Growth hormone synthesis, secretion and action
pon04973  Carbohydrate digestion and absorption
pon05010  Alzheimer disease
pon05017  Spinocerebellar ataxia
pon05132  Salmonella infection
pon05135  Yersinia infection
pon05142  Chagas disease
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05210  Colorectal cancer
pon05211  Renal cell carcinoma
pon05212  Pancreatic cancer
pon05213  Endometrial cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05220  Chronic myeloid leukemia
pon05221  Acute myeloid leukemia
pon05222  Small cell lung cancer
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05230  Central carbon metabolism in cancer
pon05231  Choline metabolism in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100442100 (AKT1)
   04012 ErbB signaling pathway
    100442100 (AKT1)
   04014 Ras signaling pathway
    100442100 (AKT1)
   04015 Rap1 signaling pathway
    100442100 (AKT1)
   04370 VEGF signaling pathway
    100442100 (AKT1)
   04371 Apelin signaling pathway
    100442100 (AKT1)
   04630 JAK-STAT signaling pathway
    100442100 (AKT1)
   04668 TNF signaling pathway
    100442100 (AKT1)
   04066 HIF-1 signaling pathway
    100442100 (AKT1)
   04068 FoxO signaling pathway
    100442100 (AKT1)
   04072 Phospholipase D signaling pathway
    100442100 (AKT1)
   04071 Sphingolipid signaling pathway
    100442100 (AKT1)
   04024 cAMP signaling pathway
    100442100 (AKT1)
   04022 cGMP-PKG signaling pathway
    100442100 (AKT1)
   04151 PI3K-Akt signaling pathway
    100442100 (AKT1)
   04152 AMPK signaling pathway
    100442100 (AKT1)
   04150 mTOR signaling pathway
    100442100 (AKT1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100442100 (AKT1)
  09143 Cell growth and death
   04210 Apoptosis
    100442100 (AKT1)
   04218 Cellular senescence
    100442100 (AKT1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100442100 (AKT1)
   04550 Signaling pathways regulating pluripotency of stem cells
    100442100 (AKT1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100442100 (AKT1)
   04613 Neutrophil extracellular trap formation
    100442100 (AKT1)
   04620 Toll-like receptor signaling pathway
    100442100 (AKT1)
   04625 C-type lectin receptor signaling pathway
    100442100 (AKT1)
   04660 T cell receptor signaling pathway
    100442100 (AKT1)
   04662 B cell receptor signaling pathway
    100442100 (AKT1)
   04664 Fc epsilon RI signaling pathway
    100442100 (AKT1)
   04666 Fc gamma R-mediated phagocytosis
    100442100 (AKT1)
   04062 Chemokine signaling pathway
    100442100 (AKT1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100442100 (AKT1)
   04922 Glucagon signaling pathway
    100442100 (AKT1)
   04923 Regulation of lipolysis in adipocytes
    100442100 (AKT1)
   04920 Adipocytokine signaling pathway
    100442100 (AKT1)
   04929 GnRH secretion
    100442100 (AKT1)
   04915 Estrogen signaling pathway
    100442100 (AKT1)
   04914 Progesterone-mediated oocyte maturation
    100442100 (AKT1)
   04917 Prolactin signaling pathway
    100442100 (AKT1)
   04926 Relaxin signaling pathway
    100442100 (AKT1)
   04935 Growth hormone synthesis, secretion and action
    100442100 (AKT1)
   04919 Thyroid hormone signaling pathway
    100442100 (AKT1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100442100 (AKT1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100442100 (AKT1)
  09156 Nervous system
   04725 Cholinergic synapse
    100442100 (AKT1)
   04728 Dopaminergic synapse
    100442100 (AKT1)
   04722 Neurotrophin signaling pathway
    100442100 (AKT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100442100 (AKT1)
  09149 Aging
   04211 Longevity regulating pathway
    100442100 (AKT1)
   04213 Longevity regulating pathway - multiple species
    100442100 (AKT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100442100 (AKT1)
   05205 Proteoglycans in cancer
    100442100 (AKT1)
   05230 Central carbon metabolism in cancer
    100442100 (AKT1)
   05231 Choline metabolism in cancer
    100442100 (AKT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100442100 (AKT1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100442100 (AKT1)
   05212 Pancreatic cancer
    100442100 (AKT1)
   05225 Hepatocellular carcinoma
    100442100 (AKT1)
   05226 Gastric cancer
    100442100 (AKT1)
   05214 Glioma
    100442100 (AKT1)
   05221 Acute myeloid leukemia
    100442100 (AKT1)
   05220 Chronic myeloid leukemia
    100442100 (AKT1)
   05218 Melanoma
    100442100 (AKT1)
   05211 Renal cell carcinoma
    100442100 (AKT1)
   05215 Prostate cancer
    100442100 (AKT1)
   05213 Endometrial cancer
    100442100 (AKT1)
   05224 Breast cancer
    100442100 (AKT1)
   05222 Small cell lung cancer
    100442100 (AKT1)
   05223 Non-small cell lung cancer
    100442100 (AKT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100442100 (AKT1)
   05017 Spinocerebellar ataxia
    100442100 (AKT1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100442100 (AKT1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100442100 (AKT1)
   04931 Insulin resistance
    100442100 (AKT1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100442100 (AKT1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100442100 (AKT1)
   05135 Yersinia infection
    100442100 (AKT1)
   05152 Tuberculosis
    100442100 (AKT1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100442100 (AKT1)
   05170 Human immunodeficiency virus 1 infection
    100442100 (AKT1)
   05161 Hepatitis B
    100442100 (AKT1)
   05160 Hepatitis C
    100442100 (AKT1)
   05164 Influenza A
    100442100 (AKT1)
   05162 Measles
    100442100 (AKT1)
   05168 Herpes simplex virus 1 infection
    100442100 (AKT1)
   05163 Human cytomegalovirus infection
    100442100 (AKT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100442100 (AKT1)
   05169 Epstein-Barr virus infection
    100442100 (AKT1)
   05165 Human papillomavirus infection
    100442100 (AKT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100442100 (AKT1)
   05142 Chagas disease
    100442100 (AKT1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100442100 (AKT1)
   01524 Platinum drug resistance
    100442100 (AKT1)
   01522 Endocrine resistance
    100442100 (AKT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100442100 (AKT1)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100442100 (AKT1)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100442100 (AKT1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like PH_11 Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 100442100
NCBI-ProteinID: XP_024087333
LinkDB
Position
14
AA seq 480 aa
MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgagcgacgtggctattgtgaaggagggctggctgcacaaacgaggggagtacatcaag
acctggcggccacgctacttcctcctcaagaatgatggcaccttcattggctacaaggag
cggccgcaggacgtggaccaacgtgaggcccccctcaacaacttctctgtggcgcagtgc
cagctgatgaagacggagcggccccggcccaacaccttcatcatccgctgcctgcagtgg
accactgtcattgaacgcaccttccacgtggagactcctgaggagcgggaggagtggaca
accgccatccagacggtggccgacggcctcaagaagcaggaggaggaggagatggacttc
cggtcgggctcacccagtgacaactcaggggctgaagagatggaggtgtccctggccaag
cccaagcaccgcgtgaccatgaatgagtttgagtacctgaagctgctgggcaagggcact
tttgggaaggtgatcctggtgaaggagaaggctacagggcgctactacgccatgaagatc
ctcaagaaggaagtcatcgtggccaaggacgaggtggcccacacactcacggagaaccgt
gtcctgcagaactccaggcaccccttcctcacggccctgaagtactctttccagacccac
gaccgcctctgcttcgtcatggagtacgccaacgggggcgagctgttcttccacctgtcc
cgggagcgtgtgttctctgaggaccgggcccgcttctatggcgctgagatcgtgtcagcc
ctggactacctgcactcggagaagaacgtggtgtaccgggacctcaagctggagaacctc
atgctggacaaggacgggcacattaagatcacagacttcgggctgtgcaaggaggggatc
aaggatggtgctaccatgaagaccttctgcggcacacccgagtacctggcccctgaggtg
ctggaggacaatgactacggccgtgcggtggactggtgggggctgggcgtggtcatgtac
gagatgatgtgcggccgcctgcccttctacaaccaggaccatgagaagctttttgagctc
atcctcatggaggagatccgcttcccgcgcacgcttggtcccgaggccaagtccttgctc
tcggggctgctcaagaaggaccccaagcagaggcttggcgggggttccgaggacgccaag
gagatcatgcagcatcgcttctttgccggcatcgtgtggcagcatgtgtacgagaagaag
ctcagcccgcccttcaagccccaggtcacatcggagaccgacaccaggtattttgacgag
gagttcacggcccagatgatcaccatcacaccacctgaccaagacgacagcatggagtgt
gtggacagcgagcgcaggccccacttcccccagttctcctactcggccagcggcacggcc
tga

KEGG   Pongo abelii (Sumatran orangutan): 100448114
Entry
100448114         CDS       T01416                                 

Gene name
AKT3
Definition
(RefSeq) RAC-gamma serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon01524  Platinum drug resistance
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04071  Sphingolipid signaling pathway
pon04072  Phospholipase D signaling pathway
pon04140  Autophagy - animal
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04210  Apoptosis
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04218  Cellular senescence
pon04261  Adrenergic signaling in cardiomyocytes
pon04370  VEGF signaling pathway
pon04371  Apelin signaling pathway
pon04380  Osteoclast differentiation
pon04510  Focal adhesion
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04611  Platelet activation
pon04613  Neutrophil extracellular trap formation
pon04620  Toll-like receptor signaling pathway
pon04625  C-type lectin receptor signaling pathway
pon04630  JAK-STAT signaling pathway
pon04660  T cell receptor signaling pathway
pon04662  B cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04668  TNF signaling pathway
pon04722  Neurotrophin signaling pathway
pon04725  Cholinergic synapse
pon04728  Dopaminergic synapse
pon04910  Insulin signaling pathway
pon04914  Progesterone-mediated oocyte maturation
pon04915  Estrogen signaling pathway
pon04917  Prolactin signaling pathway
pon04919  Thyroid hormone signaling pathway
pon04920  Adipocytokine signaling pathway
pon04922  Glucagon signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04926  Relaxin signaling pathway
pon04929  GnRH secretion
pon04931  Insulin resistance
pon04932  Non-alcoholic fatty liver disease
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04935  Growth hormone synthesis, secretion and action
pon04973  Carbohydrate digestion and absorption
pon05010  Alzheimer disease
pon05017  Spinocerebellar ataxia
pon05132  Salmonella infection
pon05135  Yersinia infection
pon05142  Chagas disease
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05210  Colorectal cancer
pon05211  Renal cell carcinoma
pon05212  Pancreatic cancer
pon05213  Endometrial cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05220  Chronic myeloid leukemia
pon05221  Acute myeloid leukemia
pon05222  Small cell lung cancer
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05230  Central carbon metabolism in cancer
pon05231  Choline metabolism in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100448114 (AKT3)
   04012 ErbB signaling pathway
    100448114 (AKT3)
   04014 Ras signaling pathway
    100448114 (AKT3)
   04015 Rap1 signaling pathway
    100448114 (AKT3)
   04370 VEGF signaling pathway
    100448114 (AKT3)
   04371 Apelin signaling pathway
    100448114 (AKT3)
   04630 JAK-STAT signaling pathway
    100448114 (AKT3)
   04668 TNF signaling pathway
    100448114 (AKT3)
   04066 HIF-1 signaling pathway
    100448114 (AKT3)
   04068 FoxO signaling pathway
    100448114 (AKT3)
   04072 Phospholipase D signaling pathway
    100448114 (AKT3)
   04071 Sphingolipid signaling pathway
    100448114 (AKT3)
   04024 cAMP signaling pathway
    100448114 (AKT3)
   04022 cGMP-PKG signaling pathway
    100448114 (AKT3)
   04151 PI3K-Akt signaling pathway
    100448114 (AKT3)
   04152 AMPK signaling pathway
    100448114 (AKT3)
   04150 mTOR signaling pathway
    100448114 (AKT3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100448114 (AKT3)
  09143 Cell growth and death
   04210 Apoptosis
    100448114 (AKT3)
   04218 Cellular senescence
    100448114 (AKT3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100448114 (AKT3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100448114 (AKT3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100448114 (AKT3)
   04613 Neutrophil extracellular trap formation
    100448114 (AKT3)
   04620 Toll-like receptor signaling pathway
    100448114 (AKT3)
   04625 C-type lectin receptor signaling pathway
    100448114 (AKT3)
   04660 T cell receptor signaling pathway
    100448114 (AKT3)
   04662 B cell receptor signaling pathway
    100448114 (AKT3)
   04664 Fc epsilon RI signaling pathway
    100448114 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    100448114 (AKT3)
   04062 Chemokine signaling pathway
    100448114 (AKT3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100448114 (AKT3)
   04922 Glucagon signaling pathway
    100448114 (AKT3)
   04923 Regulation of lipolysis in adipocytes
    100448114 (AKT3)
   04920 Adipocytokine signaling pathway
    100448114 (AKT3)
   04929 GnRH secretion
    100448114 (AKT3)
   04915 Estrogen signaling pathway
    100448114 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    100448114 (AKT3)
   04917 Prolactin signaling pathway
    100448114 (AKT3)
   04926 Relaxin signaling pathway
    100448114 (AKT3)
   04935 Growth hormone synthesis, secretion and action
    100448114 (AKT3)
   04919 Thyroid hormone signaling pathway
    100448114 (AKT3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100448114 (AKT3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100448114 (AKT3)
  09156 Nervous system
   04725 Cholinergic synapse
    100448114 (AKT3)
   04728 Dopaminergic synapse
    100448114 (AKT3)
   04722 Neurotrophin signaling pathway
    100448114 (AKT3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100448114 (AKT3)
  09149 Aging
   04211 Longevity regulating pathway
    100448114 (AKT3)
   04213 Longevity regulating pathway - multiple species
    100448114 (AKT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100448114 (AKT3)
   05205 Proteoglycans in cancer
    100448114 (AKT3)
   05230 Central carbon metabolism in cancer
    100448114 (AKT3)
   05231 Choline metabolism in cancer
    100448114 (AKT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100448114 (AKT3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100448114 (AKT3)
   05212 Pancreatic cancer
    100448114 (AKT3)
   05225 Hepatocellular carcinoma
    100448114 (AKT3)
   05226 Gastric cancer
    100448114 (AKT3)
   05214 Glioma
    100448114 (AKT3)
   05221 Acute myeloid leukemia
    100448114 (AKT3)
   05220 Chronic myeloid leukemia
    100448114 (AKT3)
   05218 Melanoma
    100448114 (AKT3)
   05211 Renal cell carcinoma
    100448114 (AKT3)
   05215 Prostate cancer
    100448114 (AKT3)
   05213 Endometrial cancer
    100448114 (AKT3)
   05224 Breast cancer
    100448114 (AKT3)
   05222 Small cell lung cancer
    100448114 (AKT3)
   05223 Non-small cell lung cancer
    100448114 (AKT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100448114 (AKT3)
   05017 Spinocerebellar ataxia
    100448114 (AKT3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100448114 (AKT3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100448114 (AKT3)
   04931 Insulin resistance
    100448114 (AKT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100448114 (AKT3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100448114 (AKT3)
   05135 Yersinia infection
    100448114 (AKT3)
   05152 Tuberculosis
    100448114 (AKT3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100448114 (AKT3)
   05170 Human immunodeficiency virus 1 infection
    100448114 (AKT3)
   05161 Hepatitis B
    100448114 (AKT3)
   05160 Hepatitis C
    100448114 (AKT3)
   05164 Influenza A
    100448114 (AKT3)
   05162 Measles
    100448114 (AKT3)
   05168 Herpes simplex virus 1 infection
    100448114 (AKT3)
   05163 Human cytomegalovirus infection
    100448114 (AKT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100448114 (AKT3)
   05169 Epstein-Barr virus infection
    100448114 (AKT3)
   05165 Human papillomavirus infection
    100448114 (AKT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100448114 (AKT3)
   05142 Chagas disease
    100448114 (AKT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100448114 (AKT3)
   01524 Platinum drug resistance
    100448114 (AKT3)
   01522 Endocrine resistance
    100448114 (AKT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100448114 (AKT3)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100448114 (AKT3)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100448114 (AKT3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Pkinase_C Kinase-like FTA2 PH_11
Other DBs
NCBI-GeneID: 100448114
NCBI-ProteinID: XP_024089813
Ensembl: ENSPPYG00000000060
LinkDB
Position
1
AA seq 479 aa
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKYDEDGMDCMDNERRPHFPQFSYSASGRE
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaagaaggttgggttcagaagaggggagaatatataaaa
aactggaggccaagatacttccttttgaagacagatggctcattcataggatataaagag
aaacctcaagatgtggatttaccttatcccctcaacaacttttcagtggcaaaatgccag
ttaatgaaaacagaacgaccaaagccaaacacatttataatcagatgtctccaatggacc
actgttatagagagaacatttcatgtagatactccagaggaaagggaagaatggacagaa
gctatccaggctgtagcggacagactgcagaggcaagaagaggagagaatgaattgtagt
ccaacttcacaaattgataatataggagaggaagagatggatgcttctacaacccatcat
aaaagaaagacaatgaatgattttgactatttgaaactactaggtaaagggacttttggg
aaagttattttggttcgagagaaggcaagtggaaaatattatgctatgaagattctgaag
aaagaagtcattattgcaaaggatgaagtggcacacactctaactgaaagcagagtatta
aagaacactagacatccctttttaacatccttgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgttaatgggggcgagctgtttttccatttgtcgagagag
cgggtgttctctgaggaccgcacacgtttctatggtgcagaaattgtctctgccttggac
tatctacattccggaaagattgtgtaccgtgatctcaagttggagaatctaatgctggac
aaagatggccacataaaaattacagattttggactttgcaaagaagggatcacagatgca
gccactatgaagacgttctgtggcactccagaatatctggcaccagaggtgttagaagat
aacgactatggccgagcagtagactggtggggcctaggggttgtcatgtatgaaatgatg
tgtgggaggctacctttctacaaccaggaccatgagaaactttttgaattaatattaatg
gaagacattaaatttcctcgaacactctcttcagatgcaaaatcattgctttcagggctc
ttgataaaggatccaaataaacgccttggtggaggaccagatgatgcaaaagaaattatg
agacacagtttcttttctggagtaaactggcaagatgtatatgataaaaagcttgtacct
ccttttaaacctcaagtaacatctgagacagatactagatattttgatgaagaatttaca
gctcagactattacaataacaccacctgaaaaatatgatgaggatggtatggactgcatg
gacaatgagaggcggccgcatttccctcaattttcctactctgcaagtggacgagaataa

KEGG   Pongo abelii (Sumatran orangutan): 100454279
Entry
100454279         CDS       T01416                                 

Gene name
AKT2
Definition
(RefSeq) RAC-beta serine/threonine-protein kinase isoform X1
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon01524  Platinum drug resistance
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04071  Sphingolipid signaling pathway
pon04072  Phospholipase D signaling pathway
pon04140  Autophagy - animal
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04210  Apoptosis
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04218  Cellular senescence
pon04261  Adrenergic signaling in cardiomyocytes
pon04370  VEGF signaling pathway
pon04371  Apelin signaling pathway
pon04380  Osteoclast differentiation
pon04510  Focal adhesion
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04611  Platelet activation
pon04613  Neutrophil extracellular trap formation
pon04620  Toll-like receptor signaling pathway
pon04625  C-type lectin receptor signaling pathway
pon04630  JAK-STAT signaling pathway
pon04660  T cell receptor signaling pathway
pon04662  B cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04668  TNF signaling pathway
pon04722  Neurotrophin signaling pathway
pon04725  Cholinergic synapse
pon04728  Dopaminergic synapse
pon04910  Insulin signaling pathway
pon04914  Progesterone-mediated oocyte maturation
pon04915  Estrogen signaling pathway
pon04917  Prolactin signaling pathway
pon04919  Thyroid hormone signaling pathway
pon04920  Adipocytokine signaling pathway
pon04922  Glucagon signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04926  Relaxin signaling pathway
pon04929  GnRH secretion
pon04931  Insulin resistance
pon04932  Non-alcoholic fatty liver disease
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04935  Growth hormone synthesis, secretion and action
pon04973  Carbohydrate digestion and absorption
pon05010  Alzheimer disease
pon05017  Spinocerebellar ataxia
pon05132  Salmonella infection
pon05135  Yersinia infection
pon05142  Chagas disease
pon05145  Toxoplasmosis
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05210  Colorectal cancer
pon05211  Renal cell carcinoma
pon05212  Pancreatic cancer
pon05213  Endometrial cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05220  Chronic myeloid leukemia
pon05221  Acute myeloid leukemia
pon05222  Small cell lung cancer
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05230  Central carbon metabolism in cancer
pon05231  Choline metabolism in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100454279 (AKT2)
   04012 ErbB signaling pathway
    100454279 (AKT2)
   04014 Ras signaling pathway
    100454279 (AKT2)
   04015 Rap1 signaling pathway
    100454279 (AKT2)
   04370 VEGF signaling pathway
    100454279 (AKT2)
   04371 Apelin signaling pathway
    100454279 (AKT2)
   04630 JAK-STAT signaling pathway
    100454279 (AKT2)
   04668 TNF signaling pathway
    100454279 (AKT2)
   04066 HIF-1 signaling pathway
    100454279 (AKT2)
   04068 FoxO signaling pathway
    100454279 (AKT2)
   04072 Phospholipase D signaling pathway
    100454279 (AKT2)
   04071 Sphingolipid signaling pathway
    100454279 (AKT2)
   04024 cAMP signaling pathway
    100454279 (AKT2)
   04022 cGMP-PKG signaling pathway
    100454279 (AKT2)
   04151 PI3K-Akt signaling pathway
    100454279 (AKT2)
   04152 AMPK signaling pathway
    100454279 (AKT2)
   04150 mTOR signaling pathway
    100454279 (AKT2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100454279 (AKT2)
  09143 Cell growth and death
   04210 Apoptosis
    100454279 (AKT2)
   04218 Cellular senescence
    100454279 (AKT2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100454279 (AKT2)
   04550 Signaling pathways regulating pluripotency of stem cells
    100454279 (AKT2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    100454279 (AKT2)
   04613 Neutrophil extracellular trap formation
    100454279 (AKT2)
   04620 Toll-like receptor signaling pathway
    100454279 (AKT2)
   04625 C-type lectin receptor signaling pathway
    100454279 (AKT2)
   04660 T cell receptor signaling pathway
    100454279 (AKT2)
   04662 B cell receptor signaling pathway
    100454279 (AKT2)
   04664 Fc epsilon RI signaling pathway
    100454279 (AKT2)
   04666 Fc gamma R-mediated phagocytosis
    100454279 (AKT2)
   04062 Chemokine signaling pathway
    100454279 (AKT2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100454279 (AKT2)
   04922 Glucagon signaling pathway
    100454279 (AKT2)
   04923 Regulation of lipolysis in adipocytes
    100454279 (AKT2)
   04920 Adipocytokine signaling pathway
    100454279 (AKT2)
   04929 GnRH secretion
    100454279 (AKT2)
   04915 Estrogen signaling pathway
    100454279 (AKT2)
   04914 Progesterone-mediated oocyte maturation
    100454279 (AKT2)
   04917 Prolactin signaling pathway
    100454279 (AKT2)
   04926 Relaxin signaling pathway
    100454279 (AKT2)
   04935 Growth hormone synthesis, secretion and action
    100454279 (AKT2)
   04919 Thyroid hormone signaling pathway
    100454279 (AKT2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100454279 (AKT2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100454279 (AKT2)
  09156 Nervous system
   04725 Cholinergic synapse
    100454279 (AKT2)
   04728 Dopaminergic synapse
    100454279 (AKT2)
   04722 Neurotrophin signaling pathway
    100454279 (AKT2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100454279 (AKT2)
  09149 Aging
   04211 Longevity regulating pathway
    100454279 (AKT2)
   04213 Longevity regulating pathway - multiple species
    100454279 (AKT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100454279 (AKT2)
   05205 Proteoglycans in cancer
    100454279 (AKT2)
   05230 Central carbon metabolism in cancer
    100454279 (AKT2)
   05231 Choline metabolism in cancer
    100454279 (AKT2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100454279 (AKT2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100454279 (AKT2)
   05212 Pancreatic cancer
    100454279 (AKT2)
   05225 Hepatocellular carcinoma
    100454279 (AKT2)
   05226 Gastric cancer
    100454279 (AKT2)
   05214 Glioma
    100454279 (AKT2)
   05221 Acute myeloid leukemia
    100454279 (AKT2)
   05220 Chronic myeloid leukemia
    100454279 (AKT2)
   05218 Melanoma
    100454279 (AKT2)
   05211 Renal cell carcinoma
    100454279 (AKT2)
   05215 Prostate cancer
    100454279 (AKT2)
   05213 Endometrial cancer
    100454279 (AKT2)
   05224 Breast cancer
    100454279 (AKT2)
   05222 Small cell lung cancer
    100454279 (AKT2)
   05223 Non-small cell lung cancer
    100454279 (AKT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100454279 (AKT2)
   05017 Spinocerebellar ataxia
    100454279 (AKT2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100454279 (AKT2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100454279 (AKT2)
   04931 Insulin resistance
    100454279 (AKT2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100454279 (AKT2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100454279 (AKT2)
   05135 Yersinia infection
    100454279 (AKT2)
   05152 Tuberculosis
    100454279 (AKT2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100454279 (AKT2)
   05170 Human immunodeficiency virus 1 infection
    100454279 (AKT2)
   05161 Hepatitis B
    100454279 (AKT2)
   05160 Hepatitis C
    100454279 (AKT2)
   05164 Influenza A
    100454279 (AKT2)
   05162 Measles
    100454279 (AKT2)
   05168 Herpes simplex virus 1 infection
    100454279 (AKT2)
   05163 Human cytomegalovirus infection
    100454279 (AKT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100454279 (AKT2)
   05169 Epstein-Barr virus infection
    100454279 (AKT2)
   05165 Human papillomavirus infection
    100454279 (AKT2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100454279 (AKT2)
   05142 Chagas disease
    100454279 (AKT2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100454279 (AKT2)
   01524 Platinum drug resistance
    100454279 (AKT2)
   01522 Endocrine resistance
    100454279 (AKT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100454279 (AKT2)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100454279 (AKT2)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   100454279 (AKT2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PH Kinase-like Pkinase_C
Other DBs
NCBI-GeneID: 100454279
NCBI-ProteinID: XP_009230881
Ensembl: ENSPPYG00000009986
UniProt: A0A6D2VYF9 H2NYU6
LinkDB
Position
19
AA seq 481 aa
MNEVSVIKEGWLHKRGEYIKTWRPRYFLLKSDGSFIGYKERPEAPDQTLPPLNNFSVAEC
QLMKTERPRPNTFVIRCLQWTTVIERTFHVDSPDEREEWMRAIQMVANSLKQRAPGEDPM
DYKCGSPSDSSTAEEMEVAVSKARAKVTMNDFDYLKLLGKGTFGKVILVREKATGRYYAM
KILRKEVIIAKDEVAHTVTESRVLQNTRHPFLTALKYAFQTHDRLCFVMEYANGGELFFH
LSRERVFTEERARFYGAEIVSALEYLHSRDVVYRDIKLENLMLDKDGHIKITDFGLCKEG
ISDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFE
LILMEEIRFPRTLSPEAKSLLAGLLKKDPKQRLGGGPSDAKEVMEHRFFLSINWQDVVQK
KLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDRYDSLGLLELDQRTHFPQFSYSASIR
E
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaacgaggtgtctgtcatcaaagaaggctggctccacaagcgtggtgaatacatcaag
acctggaggccacggtacttcctgctgaagagcgacggctccttcattggatacaaggag
aggcccgaggcccctgatcagaccctaccccccttaaacaacttctccgtagcagaatgc
cagctgatgaagaccgagaggccgcgacccaacacctttgtcatacgctgcctgcagtgg
accacagtcatcgagaggaccttccacgtggattctccagacgagagggaggagtggatg
cgggccatccagatggtcgccaatagcctcaagcagcgggccccaggcgaggaccccatg
gactacaagtgtggctcccccagtgactcctccacggctgaggagatggaagtggcggtc
agcaaggcacgggctaaagtgaccatgaatgacttcgactatctcaaactccttggcaag
ggaacctttggcaaagtcatcctggtgcgggagaaggccactggccgctactacgccatg
aagatcctgcggaaggaagtcatcattgccaaggatgaagtcgctcacacagtcaccgag
agccgggtcctccagaacaccaggcacccgttcctcactgcgctgaagtacgccttccag
acccatgaccgcctgtgcttcgtgatggagtacgccaatgggggtgagctgttcttccac
ctgtcccgggagcgtgtcttcacagaggagcgggcccggttttatggtgcagagatcgtc
tcggctcttgagtacttgcactcgcgggacgtggtataccgcgacatcaagctggaaaac
ctcatgctggacaaagatggccacatcaagatcactgactttggcctctgcaaagaaggc
atcagtgacggggccaccatgaaaaccttctgtgggaccccggagtacctggcgcctgag
gtgctggaggacaatgactatggccgggccgtggactggtgggggctgggtgtggtcatg
tacgagatgatgtgcggccgcctgcccttctacaaccaggaccacgagcgcctcttcgag
ctcatcctcatggaagagatccgcttcccgcgcacgctcagccccgaggccaagtccctg
cttgctgggctgcttaagaaggaccccaagcagaggcttggtggggggcccagcgatgcg
aaggaggtcatggagcacaggttcttcctcagcatcaactggcaggacgtggtccagaag
aagctcctgccacccttcaaacctcaggtcacgtccgaggtcgacacaaggtacttcgat
gatgaattcaccgcccagtccatcacaatcacaccccctgaccgctatgacagcctgggc
ttactggagctggaccagcggacccacttcccccagttctcctactcggccagcatccgc
gagtga

DBGET integrated database retrieval system