KEGG   Pongo abelii (Sumatran orangutan): 100442255
Entry
100442255         CDS       T01416                                 

Gene name
IRS1
Definition
(RefSeq) insulin receptor substrate 1
  KO
K16172  insulin receptor substrate 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04022  cGMP-PKG signaling pathway
pon04068  FoxO signaling pathway
pon04140  Autophagy - animal
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04722  Neurotrophin signaling pathway
pon04910  Insulin signaling pathway
pon04920  Adipocytokine signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04930  Type II diabetes mellitus
pon04931  Insulin resistance
pon04932  Non-alcoholic fatty liver disease
pon04935  Growth hormone synthesis, secretion and action
pon04960  Aldosterone-regulated sodium reabsorption
pon05010  Alzheimer disease
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100442255 (IRS1)
   04022 cGMP-PKG signaling pathway
    100442255 (IRS1)
   04151 PI3K-Akt signaling pathway
    100442255 (IRS1)
   04152 AMPK signaling pathway
    100442255 (IRS1)
   04150 mTOR signaling pathway
    100442255 (IRS1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100442255 (IRS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100442255 (IRS1)
   04923 Regulation of lipolysis in adipocytes
    100442255 (IRS1)
   04920 Adipocytokine signaling pathway
    100442255 (IRS1)
   04935 Growth hormone synthesis, secretion and action
    100442255 (IRS1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100442255 (IRS1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100442255 (IRS1)
  09149 Aging
   04211 Longevity regulating pathway
    100442255 (IRS1)
   04213 Longevity regulating pathway - multiple species
    100442255 (IRS1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100442255 (IRS1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100442255 (IRS1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100442255 (IRS1)
   04932 Non-alcoholic fatty liver disease
    100442255 (IRS1)
   04931 Insulin resistance
    100442255 (IRS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:pon04990]
    100442255 (IRS1)
Domain-containing proteins not elsewhere classified [BR:pon04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   100442255 (IRS1)
SSDB
Motif
Pfam: IRS PH PH_11
Other DBs
NCBI-GeneID: 100442255
NCBI-ProteinID: XP_002812977
UniProt: A0A2J8SHX9
LinkDB
Position
2B
AA seq 1247 aa
MASPPESDGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSSAP
KRSIPLESCFNINKRADSKNKHLVALYTRDEHFAIAADSEAEQDSWYQALLQLHNRAKGH
HDGAAALGAGGGGGSCSGSSGLGEAGEDLSYGDVPPGPAFKEVWQVILKPKGLGQTKNLI
GIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQV
DDSVVAQNMHETILEAMRAMSDEFRPRSKSQSSSNCSNPISVPLRRHHLNNPPPSQVGLT
RRSRTESITATSPASMVGGKPGSFRVRASSDGEGTMSRPASVDGSPVSPSTNRTHAHRHR
GSARLHPPLNHSRSIPMPASRCSPSATSPVSLSSSSTSGHGSTSDCLFPRRSSASVSGSP
SDGGFISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGEEELSNYICMGGKGPSTLTAPN
GQYVLSRGGNGHRYTPGTGLGTSPALAGDEAASAADLDNRFRKRTHSAGTSPTITHQKTP
SQSSVASIEEYTEMMPAYPPGGGSGGRLPGHRHSAFVPTHSYPEEGLEMHPLERRGGHHR
PDSSTLHTDDGYMPMSPGVAPVPSSRKGSGDYMPMSPKSVSAPQQIINPIRRHPQRVDPN
GYMMMSPSGGCSPDIGGGPSSSSSSSNAVPSGSSYGKLWTNGVGGHHSHVLPHPKPPVES
SSGKLLPCTGDYMNMSPVGDSNTSSPSDCYYGPENPQHKPVLSYYSLPRSFKHTQHPGEP
EEGARHQHLRLSTSSGRLLYAATADDSSSSTSSDSLGGGYCGARLEPSLPHPHHQVLQPH
LPRKVDTAAQTNSRLARPTLLSLGDPKASTLPRAREQQQQQQQQQQQPLLHPPEPKSPGE
YVNIEFGSDQPGYLSGPVASHSSPSVRCPSQLQPAPREEETGTEEYMKMDLGPGRRAAWQ
ESTGVEMGRLGPAPPGAASICRPTRAVPSSRGDYMTMQMSCPRQSYVDTSPAAPVSYADM
RTGIAAEEVSLPRATMAAASSSSAASASPTGPQGAAELAAHSSLLGGPQGPGGMSAFTRV
NLSPNRNQSAKVIRADPQGCRRRHSSETFSSTPSATRVGNTVPFGAGAAVGGGGGSSSSS
EDVKRHSSASFENVWLRPGELGGAPKEPAQLCGAAGGLENGLNYIDLDLVKDFKQRPQEC
TPEPQPPPPPPPHQPLGSGESSSTRRSSEDLSAYASISFQKQPEDRQ
NT seq 3744 nt   +upstreamnt  +downstreamnt
atggcgagccctccggagagcgatggcttctcggacgtgcgcaaggtgggctacctgcgc
aaacccaagagcatgcacaaacgcttcttcgtactgcgcgctgccagcgaggctgggggc
ccggcgcgcctcgagtactacgagaacgagaagaagtggcggcacaagtcgagcgccccc
aaacgctcgatcccccttgagagctgcttcaacatcaacaagcgggctgactccaagaac
aagcacctggtggctctctacacccgagacgagcactttgccatcgcggcggacagcgag
gccgagcaagacagctggtaccaggctctcctacagctgcacaaccgtgctaagggccac
cacgacggagctgctgccctcggtgcgggaggtggtgggggcagctgcagtggcagctcc
ggccttggtgaggctggggaggacttgagctacggtgacgtgcccccaggacccgcattc
aaagaggtctggcaggtgatcctgaagcccaagggcctgggtcagacaaagaacctgatt
ggtatctaccgcctctgcctgaccagcaagaccatcagcttcgtgaagctgaactcggag
gcagccgccgtggtgctgcagctgatgaacatcaggcgctgtggccactcggagaacttc
ttcttcatcgaggtgggccgttctgccgtgacgggtcccggggagttctggatgcaggtg
gatgactccgtggtggcccagaacatgcacgagaccatcctggaggccatgcgggccatg
agcgatgagttccgccctcgcagcaagagccagtcctcgtccaactgctctaaccccatc
agcgtccccctgcgccggcaccatctcaacaatcccccgcccagccaggtggggctgacc
cgccgatcgcgcactgagagcatcaccgccacctccccggccagcatggtgggcgggaag
ccaggctccttccgtgtccgcgcctccagtgacggcgaaggcactatgtcccgcccagcc
tcggtagacggcagccctgtgagtcccagcaccaacagaacccacgcccaccggcatcgg
ggcagcgcccggctgcaccccccgctcaaccacagccgttccatccccatgccggcttcc
cgctgctcgccttcggccaccagcccggtcagtctgtcgtccagtagcaccagtggccat
ggctccacctcggattgtctcttcccacggcgatctagtgcttcggtgtctggttccccc
agcgatggcggtttcatctcctcagatgagtatggctccagtccctgtgattttcggagt
tccttccgcagcgtcactccggattccctgggccacaccccaccagcccgcggtgaggag
gagctaagcaactatatctgcatgggtggcaaggggccctccaccctgaccgcccccaac
ggtcaatacgttttgtctcggggtggcaatggccaccgctacaccccaggaacaggcttg
ggcacgagtccagccttggctggggatgaagcagccagtgctgcagatctggataatcgg
ttccgaaagagaactcactcggcaggcacatcccctaccattacccaccagaagaccccg
tcccagtcctcagtggcttccattgaggagtatacagagatgatgcctgcctacccacca
ggaggtggcagtggaggccgactgccgggacacaggcactccgccttcgtgcccacccac
tcctacccagaggagggtctggaaatgcaccccttggagcgtcgggggggccaccaccgc
ccagacagctccaccctccacactgatgatggctacatgcccatgtccccaggggtggcc
ccagtgcccagcagccgaaagggcagtggagactatatgcccatgagtcccaagagcgtg
tctgccccacagcagatcatcaatcccatcagacgccatccccagagagtggaccccaat
ggctacatgatgatgtcccccagcggtggctgctctcctgacattggaggtggccccagc
agcagcagcagcagcagcaatgctgtcccttccgggagcagctatggaaagctgtggaca
aacggggtagggggccaccactctcatgtcttgcctcaccccaaacccccagtggagagc
agcagtggtaagctcttaccttgtacaggtgactacatgaacatgtcaccagtgggggac
tccaacaccagcagcccctccgactgctactacggccctgagaacccccagcacaagcca
gtcctctcctactactcattgccaagatcctttaagcacacccagcaccctggggagccg
gaggagggtgcccggcatcagcacctccgcctttccactagctctggtcgccttctctat
gctgcaacagcggatgattcttcctcctccaccagcagtgacagcctgggtgggggatac
tgcggggctaggctggagcccagccttccacatccccaccatcaggttctgcagccccat
ctgcctcgaaaggtggacacagctgctcagaccaatagccgcctggcccggcccacgttg
ctgtccctgggggatcccaaggccagcaccttacctcgggcccgagagcagcagcagcag
cagcagcagcagcagcagcagcccctgctgcaccctccagagcccaagagcccaggggaa
tatgtcaatattgaatttgggagtgatcagcctggctacttgtctggcccggtggcttcc
cacagctcaccttctgtcaggtgtccatcccagctccagccagctcccagagaggaagag
actggcactgaggagtacatgaagatggacctggggccgggccggagggcagcctggcag
gagagcactggggtcgagatgggcagactgggccccgcacctcccggggctgctagcatt
tgcaggcctacccgggcagtgcccagcagccggggtgactacatgaccatgcagatgagt
tgtccccgtcagagctacgtggacacctcgccagctgcccctgtaagctatgctgacatg
cggacaggcattgctgcagaggaggtgagcctgccgagggccaccatggctgctgcctcc
tcatcctcagcagcctctgcttccccgactgggcctcaaggggcagcagagctggctgcc
cactcgtccctgctggggggcccacaaggacctgggggcatgagcgccttcacccgggtg
aacctcagtcctaaccgcaaccagagtgccaaagtgatccgtgcagacccacaagggtgc
cggcggaggcatagctccgagaccttctcctcaacacccagtgccactcgggtgggcaac
acagtgccctttggagcaggggcagcagtagggggcggtggcggtagcagcagcagcagc
gaggatgtgaaacgccacagctctgcttcctttgagaatgtgtggctgaggcctggggag
cttgggggagcccccaaggagccagcccaactgtgtggggctgctgggggtttggagaat
ggtcttaactacatagacctggatttggtcaaggacttcaaacagcgccctcaggagtgc
acccctgaaccgcagcctcccccacccccaccccctcatcaacccctgggcagcggtgag
agcagctccacccgccgctcaagtgaggatttaagcgcctatgccagcatcagtttccag
aagcagccagaggaccgtcagtag

DBGET integrated database retrieval system