KEGG   Pongo abelii (Sumatran orangutan): 100442288
Entry
100442288         CDS       T01416                                 

Gene name
BRAF
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X1
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04015  Rap1 signaling pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04068  FoxO signaling pathway
pon04150  mTOR signaling pathway
pon04270  Vascular smooth muscle contraction
pon04510  Focal adhesion
pon04650  Natural killer cell mediated cytotoxicity
pon04720  Long-term potentiation
pon04722  Neurotrophin signaling pathway
pon04726  Serotonergic synapse
pon04730  Long-term depression
pon04810  Regulation of actin cytoskeleton
pon04910  Insulin signaling pathway
pon04914  Progesterone-mediated oocyte maturation
pon04928  Parathyroid hormone synthesis, secretion and action
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05034  Alcoholism
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05210  Colorectal cancer
pon05211  Renal cell carcinoma
pon05212  Pancreatic cancer
pon05213  Endometrial cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05216  Thyroid cancer
pon05218  Melanoma
pon05219  Bladder cancer
pon05220  Chronic myeloid leukemia
pon05221  Acute myeloid leukemia
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100442288 (BRAF)
   04012 ErbB signaling pathway
    100442288 (BRAF)
   04015 Rap1 signaling pathway
    100442288 (BRAF)
   04068 FoxO signaling pathway
    100442288 (BRAF)
   04024 cAMP signaling pathway
    100442288 (BRAF)
   04150 mTOR signaling pathway
    100442288 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100442288 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100442288 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100442288 (BRAF)
   04062 Chemokine signaling pathway
    100442288 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100442288 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    100442288 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    100442288 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100442288 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    100442288 (BRAF)
   04720 Long-term potentiation
    100442288 (BRAF)
   04730 Long-term depression
    100442288 (BRAF)
   04722 Neurotrophin signaling pathway
    100442288 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100442288 (BRAF)
   05205 Proteoglycans in cancer
    100442288 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100442288 (BRAF)
   05212 Pancreatic cancer
    100442288 (BRAF)
   05225 Hepatocellular carcinoma
    100442288 (BRAF)
   05226 Gastric cancer
    100442288 (BRAF)
   05214 Glioma
    100442288 (BRAF)
   05216 Thyroid cancer
    100442288 (BRAF)
   05221 Acute myeloid leukemia
    100442288 (BRAF)
   05220 Chronic myeloid leukemia
    100442288 (BRAF)
   05218 Melanoma
    100442288 (BRAF)
   05211 Renal cell carcinoma
    100442288 (BRAF)
   05219 Bladder cancer
    100442288 (BRAF)
   05215 Prostate cancer
    100442288 (BRAF)
   05213 Endometrial cancer
    100442288 (BRAF)
   05224 Breast cancer
    100442288 (BRAF)
   05223 Non-small cell lung cancer
    100442288 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100442288 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    100442288 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    100442288 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100442288 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100442288 (BRAF)
   05160 Hepatitis C
    100442288 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100442288 (BRAF)
   01522 Endocrine resistance
    100442288 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100442288 (BRAF)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100442288 (BRAF)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   100442288 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 100442288
NCBI-ProteinID: XP_009241581
Ensembl: ENSPPYG00000018061
UniProt: H2PNQ1
LinkDB
Position
7
AA seq 765 aa
MAALSGGGGGGAEPGQSLFNGDMEPEAGAGAAASSAADPAIPEEVWNIRQMIKLTQEHIE
ALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSSASMDTVTS
SSSSSLSVLPSSLSVFQNPTDVARSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLK
KALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTF
FTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQ
EEASLAETALTSGSSPSAPASDSIGPQILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDR
SSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGP
QRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAV
KMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLH
IIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKS
RWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNR
DQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLP
KIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGEFAAFK
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggcggcgctgagcggtggcggtggtggcggcgcggagccgggccagtctctgttcaac
ggggacatggagcccgaggccggcgccggcgccgcggcctcttcggctgcggaccctgcc
attccggaggaggtgtggaatatcagacaaatgattaagttgacacaggaacatatagag
gccctattggacaaatttggtggggagcataatccaccatcaatatatctggaggcctat
gaagaatacaccagcaagctagatgcactccaacaaagagaacaacagttattggaatct
ctggggaacggaactgatttttctgtttctagctctgcatcaatggataccgttacatct
tcttcctcttctagcctttcagtgctaccttcatctctttcagtttttcaaaatcccaca
gatgtggcacggagcaaccccaagtcaccacaaaaacctatcgttagagtcttcctgccc
aacaaacagaggacagtggtacctgcaaggtgtggagttacagtccgagacagtctaaag
aaagcactgatgatgagaggtctaatcccagagtgctgtgctgtttacagaattcaggat
ggagagaagaaaccaattggctgggacactgatatttcctggcttactggagaagaattg
catgtggaagtgttggagaatgttccacttacaacacacaactttgtacgaaaaacgttt
ttcaccttagcattttgtgacttttgtcgaaagctgcttttccagggtttccgctgtcaa
acatgtggttataaatttcaccagcgttgtagtacagaggttccactgatgtgtgttaat
tatgaccaacttgatttgctgtttgtctccaagttctttgaacaccacccaataccacag
gaagaggcctccttagcagagactgccctaacatctggatcatccccttccgcacccgcc
tcagactctattgggccccaaattctcaccagtccatctccttcaaaatccattccaatt
ccacagcccttccgaccagcagatgaagatcatcgaaatcaatttgggcaacgagaccgg
tcctcatcagctcccaatgtgcatataaacacaatagaacctgtcaatattgatgacttg
attagagaccaaggatttcgtggtgatggaggatcaaccacaggtttgtctgccaccccc
cctgcctcattacctggctcactaactaacgtgaaagccttacagaaatctccaggacct
cagcgagaaaggaagtcatcttcatcctcagaagacaggaatcgaatgaaaacacttggt
agacgagactcgagtgatgattgggagattcctgatgggcagattacagtgggacaaaga
attggatctggatcatttggaacagtctacaagggaaagtggcatggtgatgtggcagtg
aaaatgttgaatgtgacagcacctacacctcagcagttacaagccttcaaaaatgaagta
ggagtactcaggaaaacacgacatgtgaatatcctactcttcatgggctattccacaaag
ccacaactggctattgttacccagtggtgtgagggctccagcttgtatcaccatctccat
atcattgagaccaaatttgagatgatcaaacttatagatattgcacgacagactgcacag
ggcatggattacttacacgccaagtcaatcatccacagagacctcaagagtaataatata
tttcttcatgaagacctcacagtaaaaataggtgattttggtctagctacagtgaaatct
cgatggagtgggtcccatcagtttgaacagttgtctggatccattttgtggatggcacca
gaagtcatcagaatgcaagataaaaatccatacagctttcagtcagatgtatatgcattt
gggattgttctgtatgaattgatgactggacagttaccttattcaaacatcaacaacagg
gaccagataatttttatggtgggacgaggatacctatctccagatctcagtaaggtacgg
agtaactgtccaaaagccatgaagagattaatggcagagtgcctcaaaaagaaaagagat
gagagaccactctttccccaaattctcgcctctattgagctgctggcccgctcattgcca
aaaattcaccgcagtgcatcagaaccctccttgaatcgggctggtttccaaacagaggat
tttagtctatatgcttgtgcttctccaaaaacacccatccaggcagggggatatggagaa
tttgcagccttcaagtag

DBGET integrated database retrieval system